ויקיפדיה:הכה את המומחה/ארכיון 218

מתוך ויקיפדיה, האנציקלופדיה החופשית
קפיצה לניווט קפיצה לחיפוש
דפי ארכיון של הכה את המומחה
ארכיון כללי
1 2 3 4 5 6 7 8 9 10
11 12 13 14 15 16 17 18 19 20
21 22 23 24 25 26 27 28 29 30
31 32 33 34 35 36 37 38 39 40
41 42 43 44 45 46 47 48 49 50
51 52 53 54 55 56 57 58 59 60
61 62 63 64 65 66 67 68 69 70
71 72 73 74 75 76 77 78 79 80
81 82 83 84 85 86 87 88 89 90
91 92 93 94 95 96 97 98 99 100
101 102 103 104 105 106 107 108 109 110
111 112 113 114 115 116 117 118 119 120
121 122 123 124 125 126 127 128 129 130
131 132 133 134 135 136 137 138 139 140
141 142 143 144 145 146 147 148 149 150
151 152 153 154 155 156 157 158 159 160
161 162 163 164 165 166 167 168 169 170
171 172 173 174 175 176 177 178 179 180
181 182 183 184 185 186 187 188 189 190
191 192 193 194 195 196 197 198 199 200
201 202 203 204 205 206 207 208 209 210
211 212 213 214 215 216 217 218 219 220
221 222 223 224 225 226 227 228 229 230
231 232 233 234 235 236 237 238 239 240
241 242 243 244 245 246 247 248 249 250
251 252 253 254 255 256 257 258 259 260
261 262 263 264 265 266 267 268 269 270
271 272 273 274 275 276 277 278 279 280
281 282 283 284 285 286 287 288 289 290
291 292 293 294 295 296 297 298 299 300
ארכיון מתמטיקה
1 2 3 4 5 6 7 8 9 10
ארכיון פיזיקה
1 2 3 4 5 6 7 8 9 10
ארכיון ביולוגיה
1 2 3 4 5 6 7 8 9 10
ארכיון פסיכולוגיה
1 2 3 4 5 6 7 8 9 10

דף זה הוא דף ארכיון של דיון או הצבעה שהסתיימו. את המשך הדיון יש לקיים בדף השיחה של הערך או הנושא הנידון. אין לערוך דף זה.


תוכן עניינים

רצועת עזה[עריכת קוד מקור]

האם יש שם מדינה עצמאית? 217.132.250.31 (שיחה | תרומות | מונה) שכח/ה לחתום

ודאי, כמו קוסובו, כמו טרנסניסטריה, כמו האוטונומיה הקורדית בעיראק ועוד חבלי ארץ עצמאיים למעשה, אך לא תמיד להלכה. בברכה. ליש - שיחה 15:58, 15 באוגוסט 2013 (IDT)
באופן רשמי לא, באופן מעשי כן. ע"ע מדינה. ‏Virant‏ (שיחה) 16:02, 15 באוגוסט 2013 (IDT)
היא לא מדינה באופן חוקי, ואף שיש שם שלטון עצמאי של חמאס במידה מסוימת, בתחומים אחרים: כגון חשמל, מים, מסים וסחר עם העולם הם תלויים בישראל. בברכה, MathKnight-at-TAU שיחה 16:17, 15 באוגוסט 2013 (IDT)
לא מדובר ב"מדינה" מבחינה משפטית ואפשר לראות בערך שכבר הפנו אליו לעיל כדי לבדוק מה הם הקריטריונים המגדירים יישות כלשהי כ"מדינה". יחד עם זאת, רצועת עזה נהנת מאוטונומיה רבה בענייניה הפנימיים. גילגמש שיחה 06:45, 16 באוגוסט 2013 (IDT)
אז מי או מה בעצם מונע מהם להפוך למדינה עצמאית נורמלית?
זה לא עניין של "מה מונע", אלא לא מתקיימים התנאים שמאפשרים את הכרתם כמדינה. כשיתמלאו תנאים אלה, אפשר יהיה לראות ברצועת עזה מדינה ריבונית. גילגמש שיחה 00:20, 20 באוגוסט 2013 (IDT)
הרצועה נחשבת לשטח שמיועד למדינה הפלסטינית העתידית, לצד הגדה המערבית. הבעיה היא שכרגע שולט שם ארגון הטרור חמאס, שתפס את השלטון בהפיכה צבאית, ונתמך בידי משטר הטרור מאיראן. בגלל שהוא לא מכיר בישראל ובזכותה להתקיים, לא ניתן לחתום מולו על הסכם שיאפשר עצמאות מדינית ברצועה. אם המשטר שם יתפשר (גם אש"פ היה בעבר ארגון טרור) או יוחלף, ניתן יהיה לצרף את הרצועה באופן מלא למדינה הפלסטינית. -- הודעה זו הושארה על ידי אנונימי/ת
מה הקשר להסכם? למה המדינה לא יכולה להתקיים בלי הסכם? -- הודעה זו הושארה על ידי אנונימי/ת
מדינה אכן יכולה להתקיים גם בלי הסכם. אין הסכם שבזכותו קמה צרפת או סין או יפן ומדינות רבות אחרות. מדינות אחרות דוגמת בולגריה, ארה"ב ואחרות כן נוצרו כתוצאה מהסכם. גילגמש שיחה 09:55, 20 באוגוסט 2013 (IDT)
שאלתך לא ברורה. בהמשך לתשובת קודמי, ובהנחה שאתה מדבר על ישות מדינית ברצועת עזה, מכוח מה תקום שם מדינה ? מחר ירצה אזור רפיח, לדוגמא, שיכירו בו כישות מדינית נפרדת. מחרתיים, יהיה זה כפר באזור זה, ובשבוע הבא - חמולה וחצי בתוך הכפר הזה ישתלטו על המסגד שם, ויכריזו על מדינה. איפה הגבול (תרתי משמע) ? גם אצלנו היתה 'ישות מדינית' נפרדת לכאורה - ראה אלי אביבי. בנצי - שיחה 10:07, 20 באוגוסט 2013 (IDT)
זה לא עניין של היעדר הסכם, אלא של חוסר רצון מצד ממשלת חמאס השולטת ברצועת עזה להכריז על עזה כמדינה, מכיוון שבחמאס שואפים לכונן שלטון אסלאמי בכל ארץ ישראל ומעבר לה (ראה אמנת חמאס), כך שהסתפקות ריבונית ברצועת עזה כלל אינה עומדת על הפרק.
מדוע לדעתי רצועת עזה מהווה מדינה בפועל? משום שהיא מקיימת את התנאים לכך (ושוב אפנה לערך מדינה) מבחינת שטח, אוכלוסייה (אם כי השאיפה להחלת ריבונות לאומית/דתית על פני שטח גדול יותר אופיינית גם כאן), ממשל (חמאס הוא השלטון ואין בלתו), ולהבנתי גם עצמאות (ישות הנלחמת בישראל ולכן נתונה בסגר ימי בלתי יעיל, אך עם יכולת תנועה ומעבר סחורות כמעט בלתי מופרעת דרך המנהרות לסיני). הסעיף היחיד שאינו קיים הוא זה שציינתי לעיל כבלתי רצוי מבחינת השלטון והאוכלוסייה - הכרה על ידי הקהילה הבינלאומית. ‏Virant‏ (שיחה) 10:20, 20 באוגוסט 2013 (IDT)
וירנט, אתה היחיד שהבין את השאלה שלי, אבל אני לא מבין את התשובה שלך. בתחילת התשובה רשמת שחמאס עצמו הוא זה שמסרב להכיר במדינה של עצמו. בסוף התשובה רשמת שזה העולם לא מכיר בו. אז מה מהם הוא הנכון??--217.132.198.11 10:32, 20 באוגוסט 2013 (IDT)
באופן מוצהר החמאס מעוניין להקים מדינה ערבית בכל שטח ארץ ישראל ("פלסטין"), ולכן הוא מתקשה להסתפק במדינה ערבית על חלק קטן מהשטח. כל העולם השפוי מתנגד כמובן למדינה, כל עוד השלטון שלה הוא ארגון טרור דתי קיצוני. -- הודעה זו הושארה על ידי אנונימי/ת

מתיקות[עריכת קוד מקור]

הקפאתי בטעות בקבוק נסטי, הוצאתי אותו מהמקפיא ואחרי שמספיק מהמשקה הפשיר מזגתי לי כוס. כששתיתי שמתי לב שהמשקה מתוק יותר מבדרך כלל. זה גרם לי להזכר שכשאני שם מסטיק(לעוס) בתוך ברד ומוציא אותו לאחר שקפא מעט גם הטעם שלו מרגיש מתוק יותר. מה ההסבר לזה? -- הודעה זו הושארה על ידי אנונימי/ת

הסיבה היא פשוטה: נקודת ההתכה של מים שונה מנקודת ההתכה של החומרים האחרים מהם מורכב המשקה. מה שקורה הוא שהמרכיבים האחרים נמסים מהר יותר מאשר המים ולכן כל עוד המשקה לא הפשיר לחלוטין, אחוז המים המופשרים יהיה קטן מאחוז המרכיבים המופשרים האחרים שבמשקה, וזה פשר הטעם המחוזק שמרגישים. קובי כרמל - שיחהויקיפדיה היא אנציקלופדיה • 19:48, 15 באוגוסט 2013 (IDT)
איך זה קורה? איך הסוכרים שהפשירו מצליחים לצאת מהגוש הקפוא של המשקה ולעבור אל החלק שהפשיר? 80.230.18.149 08:59, 16 באוגוסט 2013 (IDT)
התיאור של המשיב הקודם אינו נכון, משום שמדובר בתמיסה, ואין הפשרה 'נפרדת'. מים קופאים באמצעות מנגנון של קשרי מימן בין מולקולות המים, היוצר מבנה מרחבי אופייני, עם חוזק ותכונות אופייניות אחרות. כאשר ממיסים מומס כלשהו במים, סוכר למשל, מולקולות המים נקשרות למולקולות הסוכר (זו בעצם תופעת ההתמוססות), ולכן במהלך קפיאה הקשרים הללו מפריעים לתהליך הקפיאה הרגיל, ויש צורך בטמפ' נמוכה עוד יותר כדי להגיע למצב צבירה מוצק. בכיוון ההפוך, כלומר בהפשרה, חלק המים שכלל מומסים מפשיר קודם, וככל שהמים המפשירים טהורים יותר, כך הפשרתם מאוחרת יותר, משום שנחוץ זמן רב יותר ע"מ שיצטבר מספיק חום להפשרתם. בנצי - שיחה 13:02, 16 באוגוסט 2013 (IDT)
האם התמיסה אינה אחידה? למה איזור מסויים של התמיסה כולל יותר מומסים ואיזור אחר כולל פחות מומסים? 80.230.18.149 09:54, 18 באוגוסט 2013 (IDT)
בחלק מהמקרים היא לא ממשיכה להיות אחידה במהלך הקפיאה. קשרי המימן דוחקים, לפחות חלקית, את מקומם של קשרים אחרים, קודמים. האם ניסית לשתות קולה או משקה מוגז אחר, לאחר שהוקפאו ? בנצי - שיחה 18:24, 18 באוגוסט 2013 (IDT)
לא ניסיתי. אני מניח שחלק מהגז ייפרד מהנוזל במהלך ההקפאה, ואחרי ההפשרה נקבל משקה פחות מוגז. מה קורה אם מקפיאים כמות גדולה בקור חזק [1] ? האם במקרה כזה אחרי ההפשרה נקבל משקה מוגז? האם חלק מהגז נפרד מהנוזל גם במהלך ההפשרה? 80.230.18.149 22:12, 18 באוגוסט 2013 (IDT)

הסיבות למנהג הישראלי לעקוף בתורים[עריכת קוד מקור]

מה הסיבות ההיסטוריות/תרבותיות למנהג הזה? יש עוד מדינות (בעיקר מפותחות) שבהן זה כ"כ מקובל? מתי החל המנהג? תודה רבה, 84.109.248.221 19:49, 15 באוגוסט 2013 (IDT)

זה ממש לא "מנהג ישראלי". יצא לך לבקר במדינות ערב? גם במדינות מפותחות התופעה מאוד נפוצה. בעיקר באיטליה ובספרד, למרות שזה נעשה שם לעתים בחן מסויים, משום שאין ממש "תור" אלא התגודדות רבתית. מה הסיבות לכך שזה נפוץ בישראל? כנראה שילוב של אותן סיבות שהניבו את יתר המאפיינים של מה שמכונה "הישראלי המכוער": מציאות חיים לא קלה במזרח התיכון (ואולי גם השפעה מהשכנות במזרח התיכון), שירות צבאי חובה, ואסרטיביות יהודית טיפוסית שלא סובלת בזבוז זמן. לחברה הישראלית גם אין את היתרון שיש למדינות מפותחות אחרות, כמו אנגליה נניח, של סדר חברתי שהתגבש לאורך מאות שנים. ג'יס - שיחה 21:39, 15 באוגוסט 2013 (IDT)
אנחנו פשוט מייצגים 'מצב ביניים' בין מדינות מערביות, הדוגמה הבולטת היא אנגליה לבין מדינות ערב ומדינות מפתחות. רואים את זה גם בתרבות הנהיגה. אני חייב לציין בהקשר זה גם את היתרונות שבנורמות הנהוגות במדינות 'עולם שלישי' לכאורה. לדוגמה, הימנעות מנהיגה בשולי הכביש, מצמצמת את נפח התנועה בכביש. נתיב תחבורה ציבורית שהונהג בכביש החוף בין נתניה להרצליה, למעשה בשולי הכביש, מגדיל בהרבה את התנועה בכביש, עד כה ללא תוצאות שליליות כמו תאונות דרכים. דוגמה אחרת- בתחבורה ציבורית, במדינות מערביות נהוגים קווי אוטובוסים שיוצאים בשעות מוגדרות, וכך פעמים רבות האוטובוס יוצא ריק או עם מעט נוסעים, דבר שמהווה בזבוז משאבים. זאת לעומת הנוהג במקומות אחרים, בו הרכב יוצא רק כשהוא מלא, ויש בו צורך מוכח (כמו במוניות שירות בארץ) אוריה אורן - שיחה 23:40, 15 באוגוסט 2013 (IDT)

דמוקרטיה וצדק[עריכת קוד מקור]

האם שלטון חופשי דורש בחירות? האם יתכן משטר חופשי בו הממשל לא נבחר על ידי ההמון?

האם הרעיון שאבסטרקטי של "צדק" דורש דמוקרטיה (כלומר העם בחור את נציגיו בשלטון)?

האם אפשר לדמיין משטר צודק, בו לפרט יש חופש לבחור את גורלו, אך השלטון לא נבחר על ידי הצבעה המונית? 109.65.154.132 23:20, 15 באוגוסט 2013 (IDT)

לא בהכרח, כבר אמרו שדמוקרטיה היא פשוט השיטה הפחות גרועה מכל שאר השיטות. למשל, ייתכן משטר מלוכני שהמלך בו מקדש זכויות אדם וכל תושבי המדינה מרוצים ממנו.
צדק לא דורש דמוקרטיה. ייתכן מצב של "עריצות הרוב" לפיו אין לקיים את הכרעת הרוב אלא לתמוך בזכויות מיעוטים. יש גם "דמוקרטיה מתגוננת" - נציגי העם לא בהכרח ייכנסו לשלטון אם הם פועלים נגד עקרונות הדמוקרטיה.
כמובן, ייתכן מצב תיאורטי בו מוקמת וועדה המקדשת עקרונות של חופש וזכויות ובוחרת באופן מקצועי מנהיג (מול מצב בו העם בוחר מנהיג באופן רגשי לא ענייני). הבעיה היא שעניין כזה הוא תיאורטי לחלוטין ולא סביר שיעמוד במבחן המציאות, קשה לפקח ולמנוע שחיתויות (כולנו בני אדם וכולי). דמוקרטיה מועדפת על רבים, כיוון שלכל אזרח יש השפעה ישירה על השלטון. אופק כחול - ביבר הזכוכית 23:40, 15 באוגוסט 2013 (IDT)
המשפט האחרון הוא זה שאני מערער על נכותנו. מדוע החשיבה המקובלת היום שהצבעה המונית היא המפתח לצדק, חופש ושוויון? הצבעה המונית הופכת את הפוליטיקאי מאיש ביצוע בעל מטרות מעשיות לאיש בידור שהתפקיד שלו לשלהב את הקהל לבחור בו. הוא יכול לפגוע במדינה במטרה להציג את עצמו מול המצלמות בצורה יותר סימפתית. 109.65.154.132 11:00, 16 באוגוסט 2013 (IDT)
החשיבה המקובלת היום שהצבעה המונית היא המפתח לצדק, חופש ושוויון מתבססת על ניסיון של כמאתיים שנה. כל השיטות האחרות שנוסו לא היו כה טובות. Nachum - שיחה 11:13, 16 באוגוסט 2013 (IDT)
מאתיים שנה זה לא הרבה אפילו בקנה מידה של ההיסטוריה האנושית. וזה שכל השיטות שניסו עד כה לא הובילו לתוצאה חיובית, עדיין לא שאין שיטה יותר טובה. ולא הייתי אומר שהצבעה המונית כן מובילה רק לתוצאות חיוביות. 109.65.154.132 11:26, 16 באוגוסט 2013 (IDT)
יש פה בלבול רב. דמוקרטיה היא בפירוש לא שלטון הרוב. היא גם לא "הצבעת המונים שלכל אחד מהם הפשעה ישירה". אני מציע לקרוא את הערך דמוקרטיה וערכים בקט' הרלוונטית לקבלת רקע נוסף. גילגמש שיחה 12:08, 16 באוגוסט 2013 (IDT)
בסינגפור פועל משטר, שקשה מאוד להגדיר אותו דמוקרטי, הן מצד שיטת הבחירה והן מצד ערכי יסוד נוספים של דמוקרטיה. "קשה" זה עניין יחסי, שכן אנשי המקום מגדירים את מדינתם כדמוקרטית. יחד עם זאת, כנראה זו אחת המדינות הפחות מושחתות בעולם, ואחת המדינות שיותר טוב לגור בהן הן מבחינת רמת החיים, הן מבחינת הבטחון האישי, והן מבחינת האווירה והסולידריות החברתית. משה פרידמן - שיחה 21:46, 18 באוגוסט 2013 (IDT)

ראו גם: דיקטטור נאור. Corvus,(שיחה) 12:59, 24 באוגוסט 2013 (IDT)

ערך חדש לויקיפדיה[עריכת קוד מקור]

שלום. פתחתי משתמש וברצוני להוסיף ערך חדש. נתגלה זן יונקים חדש בשם אולינגיטו - האם יש עורך מנוסה שיכול לסייע בכתיבת הערך? זיו דובינסקי.

האולינגוויטו חי בעיקר בשעות הלילה, ביערות ההרריים שבין אקוואדור וקולומביה. כריסטופר הלגן, חוקר ממוסד המחקר האמריקני "סמיתסוניאן". -- הודעה זו הושארה על ידי אנונימי/ת
גם Er sieht aus wie eine Mischung aus Katze und Teddybär: der Olinguito. Nachum - שיחה 10:52, 16 באוגוסט 2013 (IDT)
אולינגויטו, זהו הערך החדש. Nachum - שיחה 15:13, 16 באוגוסט 2013 (IDT)

SMTP כללי[עריכת קוד מקור]

האם יש שרתי SMTP כלליים?, כלומר שמטפלים בבקשות מהמשתמש ששייכות לכל השרתים ומבצעים את ההתקשרות מול השרת הנצרך ספציפית? --31.44.142.219 14:33, 16 באוגוסט 2013 (IDT)

מה זה "כלליים"?
הפעלת שרת, ובעיקר רוחב הפס הנלווה עולה כסף, לעתים כסף רב. בשל כך, אין שרתים "יתומים" בעולם. כל שרת מייל מופעל על-ידי מישהו.
פרוטוקל SMTP אומר שעל השרת להעביר את הבקשה הלאה לשרת הסמוך אליו הקרוב יותר ליעד/נמען.
באופן כללי, אם שרת של Yahoo מעביר מייל (מכתובת מקור user@example.com) לשרת של GMail, שרת ה-GMail יעביר את המייל לתעודותו (בין אם היא פנימית, או חיצונית, בהמשך הדרך).
אם זאת-במידה ונתח ניכר מהדואר ששרתי Yahoo מעבירים לגוגל מתגלים כספאם, אזי גוגל עשויה פשוט לנתק עצמה מ-Yahoo, על-ידי כך שלא תעביר כל מייל ממנה.
על עצם פשטות ה-SMTP בנויה מערכת הספאם העולמית. ברגע ששרת אחד היה מוכן להעביר את המייל שלך, כל השרתים הבאים בדרך כבר יהיו מוכנים לקדם את המייל שלך לתעודתו.
החסם הוא ששרת SMTP של Yahoo בד"כ יפיל מייל שנשלח מכתובת מזוייפת.
לעומת-זאת באוניברסיטה העברית, שרתי ה-SMTP היו מוכנים לדוור הלאה כל דואר מדומיין HUJI, אף שלא נשלח מחשבון המשתמש המתאים.
ככה היינו שולחים מיילי מתיחה אחד לשני תחת שמות בדויים.
DoronWise - שיחה 15:56, 16 באוגוסט 2013 (IDT)
אני מתכוין לתהליך האימות של המשתמש. המשתמש SomeOne@gmail.com יכול לאמת את שם המשתמש והסיסמא שלו (ואז לבצע את השליחה) רק מול שרת smtp.gmail.com, אם הבקשה תגיע ל SMTP של יאהו היא תיכשל.
שאלתי היא האם יש שרת שמסוגל לקבל כל שם משתמש מכל 'תחום' ולנסות לאמת אותו מול השרת הרלוונטי. במידה והוא מאומת ההודעה תישלח.

לדוגמא: (אם אתה מבין בVB): המשתמש יכניס שם משתמש וסיסמא הענין הוא שההודעה תישלח רק אם הוא הכניס שם משתמש של Gmail. האם יש שרת 'כללי' שיבדוק אל מול השרת הרלוונטי?

Dim mail As New MailMessage()
        Dim SmtpServer As New SmtpClient
        SmtpServer.Credentials = New Net.NetworkCredential("Email@XXX.com", "Password")
        SmtpServer.Port = 587
'השרת שיטפל בבקשה
        SmtpServer.Host = "smtp.gmail.com"

        SmtpServer.EnableSsl = True
        mail.To.Add("Myfriend@gmail.com")
        mail.From = New MailAddress("Email@XXX.com")
        mail.Subject = "נושא ההודעה"
        mail.Body = " תוכן ההודעה"
        SmtpServer.Send(mail)

תוקן DoronWise - שיחה 12:41, 27 באוגוסט 2013 (IDT)

סאדו-מאזו[עריכת קוד מקור]

האם ידוע מתי בערך נוצר הביטוי "סאדו-מאזו"? ברור שהכי מוקדם היה במאה ה-19, מאחר שזה על שם המרקיז דה סאד, אבל האם ידוע מתי בערך המושג הזה נטבע? אוריה בר-מאיר - שיחה 13:56, 17 באוגוסט 2013 (IDT)

This led to the first compound usage of the terminology in Sado-Masochism (Loureiroian "Sado-Masochismus") by the Viennese Psychoanalyst Isidor Isaak Sadger in his work Über den sado-masochistischen Komplex ("Regarding the sadomasochistic complex") in 1913]: ב-1913. -- הודעה זו הושארה על ידי אנונימי/ת
Isidor Isaak Sadger (* 29. Oktober 1867 in Neu-Sandez, Galizien; † 21. Dezember 1942 im Ghetto Theresienstadt) war ein jüdischer Arzt und Psychoanalytiker in Wien. nachum

מי הוא יושב ראש המועצה הארצית לתכנון ובנייה?[עריכת קוד מקור]

ואם יודעים - ממתי עד מתי הוא מכהן? תודה!!! -- הודעה זו הושארה על ידי אנונימי/ת

יגאל צרפתי. חזרתישיחה 18:52, 17 באוגוסט 2013 (IDT)
תודה חזרתי, ויש לי עוד שאלה אולי אתה (או מישהו אחר) יודע מתי תכנית עשרת היישובים (במבואות ערד) הופקדה לעיון הציבור? ניסיתי לחפש פרטים אודותיה אך ללא הצלחה. שבוע טוב. -- הודעה זו הושארה על ידי אנונימי/ת

שאלה בביואינפורמטיקה[עריכת קוד מקור]

מה פשר המספרים או הקודים בשורה הראשונה בדוגמא שלהלן, בפורמט FASTA:

>gi|5524211|gb|AAD44166.1| cytochrome b [Elephas maximus maximus] LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSAIPYIGTNLV EWIWGGFSVDKATLNRFFAFHFILPFTMVALAGVHLTFLHETGSNNPLGLTSDSDKIPFHPYYTIKDFLG LLILILLLLLLALLSPDMLGDPDNHMPADPLNTPLHIKPEWYFLFAYAILRSVPNKLGGVLALFLSIVIL GLMPFLHTSKHRSMMLRPLSQALFWTLTMDLLTLTWIGSQPVEYPYTIIGQMASILYFSIILAFLPIAGX IENY

תודה, בנצי - שיחה 19:19, 17 באוגוסט 2013 (IDT)

ר' FASTA format#Sequence identifiers. בדוגמא שהבאת מדובר באינדקסים ל-GenBank. בכל מקרה זה חלק מהכותרת/הערה, ולא חלק מתאור הרצף. ‏[kotz]‏ [שיחה] 16:48, 18 באוגוסט 2013 (IDT)

מהי מערכת הלימפה ?[עריכת קוד מקור]

היי, אני תלמיד ולמדתי את כל האנטומיה הבסיסית של הגוף חוץ מדבר אחד שתמיד היה קשה לי להבין וזה מערכת הלימפה. המערכת הזאת לא ברורה לי בעליל למרות מה שקראתי בערכה בויקיפדיה. האם ניתן לומר שמערכת הלימפה זוהי מערכת מקבילה למערכת הדם, או תת מערכת שלה? לפי מה שקראתי הבנתי שמערכת הלימפה מכילה רק נימים בשונה ממערכת הדם המכילה עורקים וורידים, האם אכן המערכת בנויה רק מנימים המתנקזים בסופו של דבר לבלוטות? האם נימים אלה ניתנים לזיהוי בעין בלתי מזוינת בעת ניתוח אנטומי? קראתי בערך של מערכת הלימפה שהיא זו שמעבירה תאים לבנים מהרקמות למחזור הדם. האם מערכת זו מעבירה רק תאים לבנים או שהיא מעבירה גם את שאר התאים והטסיות? (אם לא, מי מעביר למחזור הדם את התאים או את שבריהם (טסיות) ממח העצם למחזור הדם?). מסקרן אותי להבין את המערכת הזאת, ואשמח אם תלמדו אותי עליה. 46.210.137.94 19:31, 17 באוגוסט 2013 (IDT)

מערכת הלימפה דומה במובן מסוים למערכת כלי הדם. בדומה למערכת כלי הדם, גם למערכת הלימפה יש צינורות שבהם זורם נוזל הלימפה. בזה בעצם מסתיים הדמיון בין מערכת הלימפה למערכת הדם. מערכת הלימפה אחראית בעיקר למעבר תאי דם לבנים שמרביתם נמצאים בקשרי לימפה. תאי הדם הלבנים נחוצים כדי להלחם בחיידקים שונים. אין זה אומר שאין תאי דם לבנים בכלי הדם הרגילים - יש גם יש, אבל מקום שבו נמצאים רוב תאי הדם הלבנים הוא בבלוטות הלימפה. כמו כן, מלבד השימוש שעושה הגוף במערכת הלימפה למעבר תאי דם לבנים, יש לה עוד כמה תפקידים חשובים כמו קליטת נוזל בין תאי, קליטת חומצות שומן ממערכת העיכול ועוד. כמו כן, חשוב לציין שיש קשר בין מערכת הדם למערכת הלימפה. נוזל הלימפה הוא למעשה דם מסונן. בלימפה אין תאי דם אדומים או טסיות. גילגמש שיחה 07:28, 18 באוגוסט 2013 (IDT)

על חום גופנו ועל הרגשת החום[עריכת קוד מקור]

שלום, כידוע טמפרטורת הגוף הממוצעת/הבריאה שלנו בני האדם היא 37 מעלות פחות או יותר, וזה בערך החום האידיאלי אליו הגוף שואף. אז התעוררה אצלי שאלה בעקבות המידע הזה, וזה מדוע בעצם כשיש בחוץ 37 מעלות אנו מחשיבים את זה כחם ובלתי נסבל ואילו 25 מעלות נחשבות נוחות יותר. האם לא היה צריך להתקיים שטמפרטורה חיצונית של 37 היא הנעימה/נוחה ביותר, ואילו כל ערך מתחת לזה יחשב לקר, וכל ערך מעל לזה יחשב כחם? --Yoyosasa - שיחה 04:42, 18 באוגוסט 2013 (IDT)

על רגל אחת: ב-37° בחוץ הגוף לא יכול לווסת את החום שבו ביעילות, וגם לא בטמפרטורות סמוכות לזה. חזרתישיחה 06:30, 18 באוגוסט 2013 (IDT)
כתבתי לפני התנגשות עריכה: במצב כזה גוף האדם לא יכול היה לפלוט אנרגיה עודפת לסביבה עקב פעילות כלשהי שלו, בעיקר בתהליך הזעה. עוד דבר: הפרשי טמפ' אינם כל הסיפור, ויעילות סילוק חום מהגוף תלויה גם בלחות האויר. שילוב השניים מבטאת את יכולתנו לשמור על טמפ' קבועה של 370C, והוא מכונה עומס חום. בנצי - שיחה 06:40, 18 באוגוסט 2013 (IDT)

היתרון האבולוציוני של המוזיקה?[עריכת קוד מקור]

מה היא בעצם הסיבה האבולוציונית לכך שהמוח יכול להפיק הנאה ממוזיקה? --Yoyosasa - שיחה 04:42, 18 באוגוסט 2013 (IDT)

אולי הספר הבא יכול לענות לך (אין לי מושג מי הכותב ומהי רמת ההשכלה שלו): Why do People Sing? Music in Human Evolution. – ‏Manedwolf‏ • שיחה 10:01, 18 באוגוסט 2013 (IDT)
יש לספר הזה ערך בוויקיפדיה האנגלית, אבל לפי הפרק Controversies הוא נראה לי לא רציני במיוחד, גם אם סביר שיש בו הרבה טענות נכונות שיענו על השאלה. יכול להיות שהערך Evolutionary musicology יענה טוב יותר. נו, טובשיחה 20:34, 18 באוגוסט 2013 (IDT)

איפה אפשר[עריכת קוד מקור]

למצוא היסטוריה של ערך שנמחק? -- הודעה זו הושארה על ידי אנונימי/ת

כותרת ? -- הודעה זו הושארה על ידי אנונימי/ת
מה כותרת? היסטוריית גרסאות מחוקות(ושל ערך מחוק) נגישה רק למפעילי מערכת. Corvus,(שיחה) 11:49, 18 באוגוסט 2013 (IDT)
ה'כותרת' לא קשורה לתוכן השאלה. לפני ששיניתי, השאלה הופיעה בכותרת בלבד, ואיזשהו אלמוני הגיב בזריקת המילה 'כותרת'. בנצי - שיחה 12:36, 18 באוגוסט 2013 (IDT)

מֶטרוֹנית[עריכת קוד מקור]

לפי הערך מטרונית יש באוטובוס א(ו)רוך 40 מקומות ישיבה. כמה מקומות ישיבה יש באוטובוס רגיל (כזה של טיולים, לא עם המרווח הריק באמצע)? 109.65.154.132 10:41, 18 באוגוסט 2013 (IDT)

מילדותי אני זוכר את המספר 58 מושבים באוטובוס של טיולי בי"ס. בערך אוטובוסים בישראל כתוב 87 מושבים באוטובוס קומתיים של אגד ורומז "53 באוטובוס רגיל". ‏[kotz]‏ [שיחה] 12:59, 18 באוגוסט 2013 (IDT)
יש מגוון סוגי 'אוטובוסי טיולים' ומספר המקומות בהם הוא 50 עד 55 (יש יותר מכך ויש גם פחות מכך, תלוי בעיצוב האוטובוס), באוטובוסים עירוניים יש הרבה פחות מקומות ישיבה והרבה יותר מקום לאנשים עומדים וכך גם במטרונית הבנויה לעד כ-100 אנשים כולל עמידה. עם זאת יתכן שבשעות השיא יכנסו יותר אנשים, בברכה, Nurick - שיחה 18:35, 18 באוגוסט 2013 (IDT)

האם האזור בו ניבנו הפירמידות היה מאוכלס?[עריכת קוד מקור]

מתחם הפירמידות בגיזה, 2008

ממשחקי מחשב שונים כמו Pharaoh קיבלתי בעבר את הרושם שהאזורים בהם נמצאים רוב הפירמידות היו מאוכלסים בשכונות מגורים (אולי של עבדים בעיקר) בימי קדם, ושמסיבות שונות האזור היום צחיח במקרה הטוב ודיוניטי במקרה הרע... האם יש לכך תמיכה אריכיאולוגית? תודה. ‏Ben-Natan‏ • שיחה 12:05, 18 באוגוסט 2013 (IDT)

כן. נחשפו ערים שלמות, כולל בתי מגורים, גם כאלה המעידים על בעלים שנשאו תפקידים רמים בארגון שהיה אחראי להקמת מפעלי ענק אלה, וגם בתי קברות. הם לא היו בהכרח עבדים. רבים מהם היו כפריים שבחרו בכך כדי להתפרנס. ככל הידוע לי, 'עיירות' אלה היו צמודות למחצבות הענק בהן נכרו ועובדו האבנים. בנצי - שיחה 12:41, 18 באוגוסט 2013 (IDT)
כיום האזור לא מבודד ולא ריק, ראה בתמונה שפרברי קהיר הגיעו אליו. הוא נמצא כ-25 ק"מ ממרכז העיר קהיר (העיר הגדולה ביותר באפריקה ובמזה"ת), וכ-9 ק"מ מהעיר גיזה (העיר השלישית בגודלה במצרים). -- הודעה זו הושארה על ידי אנונימי/ת
ייתכן שארץ גושן המקראית הייתה באזור הזה גם, ויכול להיות שימצאו שם בתים של עבדי בני ישראל, אבל כל עוד אנחנו לא חוקרים ומחפשים שם, לא יימצא שם כלום (או שיימצא ופשוט יכחישו). FireSky - שיחה 18:56, 19 באוגוסט 2013 (IDT)
אני לא מבין על מה אתה מבתסס כשאתה כותב את התשובה הזאת. גילגמש שיחה 19:03, 19 באוגוסט 2013 (IDT)
אני מתבסס על התנ"ך, אבל גם אמרתי ייתכן, וכידוע לי להמון אירועים מהתנ"ך כבר נמצאו הוכחות ארכאולוגיות. אז למה לא לזה? ולפי הערך על גושן, הארץ הייתה כנראה סמוכה לערים הפרעוניות, בחיבור העובדה שבני ישראל היו עבדים לפי התנ"ך, ושהפירמידות כמובן לא נבנו על ידי המצרים אלא על ידי עבדיהם, אפשר לגלות שם דברים מעניינים. FireSky - שיחה 19:05, 19 באוגוסט 2013 (IDT)
הכה את המומחה מיועד לשאלות של אנשים שאינם יודעים את התשובה, אם אתה בעצמך לא מומחה בסוגיה אז עדיף שלא תגיב. לגופו של עניין: הפירמידות לא נבנו על ידי עבדים ולא נבנו על ידי "עברים" - מה שזה לא יהיה. ובוודאי שהיה יישוב גדול ליד הפירמידות שאלכס את הפועלים. הפירמידות נבנו לאורך עשרות שנים על ידי צוותים גדולים מאוד. גילגמש שיחה 19:09, 19 באוגוסט 2013 (IDT)
אתה צודק, הם כנראה נבנו על ידי חייזרים באמת התבלבלתי. אם אני ארצה להגיב אני אגיב מה שאני חושב, ולפסול משהו רק בגלל שזה מגיע מהתנ"ך המפוקפק הלא אמיתי בכלל, בלי שאתה יודע מה באמת קבור שם באדמה סמוך לפירמידות, ואילו סודות עוד לא גילינו. בני ישראל היו עבדים במצרים מאות שנים, וכשיש לך משהו שכתוב כל כך הרבה שנים, בלי גרסא חזקה אחרת שתסתור אותו, זה חוצפה לפסול אותו. FireSky - שיחה 19:14, 19 באוגוסט 2013 (IDT)
אין זה דיון על דיוקו של ספר שמות או כל ספר אחר בתנך. גם בתנ"ך לא כתוב שני ישראל בנו את הפירמידות. יתרה מכך, לא נכון לומר ש"לא באמת יודעים מה קבור שם באדמה". יודעים גם יודעים. חפרו גם חפרו באזור. כך שאתה לכל הפחות לא מעודכן. גילגמש שיחה 19:21, 19 באוגוסט 2013 (IDT)
אוח, ברור לי שחפרו, התכוונתי למה שעדיין לא גילו! ומה שכבר גילו, שבוני הפירמידות היו כביכול פועלים שכירים (כשיש למצרים עבדים בשפע היא ממש תבזבז כסף כשהיא יכולה לכפות את זה על מישהו - נשמע מאוד הגיוני). אם אני לא טועה זכור לי פסוק שכן מדבר על זה שבני ישראל בנו את הפירמידות, כשמשה מציל תינוק בשם מיכה מלהכניס אותו לתוך חורים בפירמידה בתור לבנה (ככה לפי התנ"ך התעללו בתינוקות בנוסף לזריקה ליאור, השתמשו בהם כלבנים בפירמידות). ארכאולוגיה אף פעם לא הייתה מדע מדויק, ורוב מה שמתגלה הוא בגדר השערות, וכשעם שלם מחזיק ספר במשך אלפי שנים שבו כתוב בפירוש את ההיסטוריה שלו, זה הוכחה מהימנה יותר מלמצוא גופות קבורות סמוך לפירמידות ולידם שאריות בשר ולהחליט שהם היו עובדים שכירים שבנו אותן. FireSky - שיחה 19:33, 19 באוגוסט 2013 (IDT)
העובדה שנמצאו טבלאות השכר של העובדים, למשל, היא ממצא משכנע למדי. כמותו יש עוד מאות. ולרישא של דבריך - הכה את המומחה מיועד לעונים מתוך ידע. הכה את המנחש זה מדור אחר לגמרי. אלה הכללים כאן. הפיקנופודיה טובה ממך! אילן שמעוני, - שיחה 20:06, 19 באוגוסט 2013 (IDT)
א. זכותך לחשוב מה שאתה רוצה. אבל בבואך להעלות טיעון עליך לבסס אותו. אין לך מונופול על התנ"ך, ובודאי שלא להטיח ביקורת על הזולת הסבור שיש להקשיב גם לממצא המדעי. כדי לבוא עם טיעונים כה חד-משמעיים בסוגיות אלה, מן הראוי שתלמד מעט על הבעיות שהמקרא מציב לכל המעיין בו, ולא פחות מכך, על טיבה של ארכיאולוגיה. הצהרות מדוקלמות ולא מדוייקות בעליל אינן תחליף ללמידה יסודית של כל ההיבטים הנוגעים לסוגיה נדונה. הבמה הזו ראויה לכך שלמידה יסודית של נושא נדון תקדים 'השאת משואות', שמא יתברר שאינך בקיא בהלכות קידוש החודש, ותמצא את עצמך ואת עדותך מובכים.
ב. לדוגמא, מלמידה יסודית של בחינת ממצאים ארכיאולוגיים היית מבין כיצד מתארכים אותם. מה לעשות, השלדים שנתגלו לא מתאימים מבחינת גילם, לתקופת העבדות לפי הסיפור המקראי. יתרה מזאת, הפירמידות עצמן נבנו זמן רב קודם לכן. אמונה דתית היא עניין מכובד. אמונה דתית אוריינית היא דבר מכובד עוד יותר. בנצי - שיחה 00:03, 20 באוגוסט 2013 (IDT)
(בתורה אין אף מלה על פירמידות. "ויבן ערי מסכנות לפרעה, את פִתם ואת רעמסס"). עוזי ו. - שיחה 01:11, 20 באוגוסט 2013 (IDT)
מסכים עם קודמיי, ואוסיף כמה הבהרות: 1) הפירמידות נבנו בתחילת-אמצע האלף השלישי לפני הספירה, כלומר אלף שנה לפני תקופת העבדות של בני ישראל, אם אכן התקיימה; 2) נכון שמצאו עדויות ארכיאולוגיות המתאימות לאירועים המוזכרים בתנ"ך, אבל לחלק המתואר בספרי הנביאים, לא לפני כן; 3) אם אתה רוצה לבנות מונומנט שיעמוד כמו שצריך, עדיף שתשתמש בבנאים מקצועיים ומיומנים ותתגמל אותם כיאות. זה נכון היום וגם לפני 4,500 שנה; 4) בחזרה לשאלה המקורית, האזור היה יכול להיות (ואכן היה) צחיח וגם מאוכלס - אין סתירה. הציוויליזציה המצרית הסתמכה כמובן על ההשקיה מהנילוס למרות מיקומה באזור מדברי. Reuveny - שיחה 01:22, 20 באוגוסט 2013 (IDT)
עוד משהו קטן. ניתן לראות משרשור זה כי ישנה חשיבות רבה לאבחנה בין מה שכתוב בתנ"ך לבין מה שהוסיפו עליו פרשני התנ"ך או חז"ל. אנשים רבים רגילים ללמוד את התנ"ך בצמידות מוגזמת למדרשי חז"ל, וכך לעתים הזיכרון מטעה אותם לחשוב שמשהו שהם למדו ממדרש חז"ל נמצא בפסוקים עצמם. חשיבות נוספת ישנה ללימוד המקורות בעצמך כאשר אתה מבוגר. הסתמכות על הזיכרון בלבד, עשויה להכניס את פרשנות הגננת או המורה שמהם למדת כשהיית ילד, אל תוך הטקסט, בלא שפרשנות זו נמצאת שם באמת. שתי השגיאות שתיארתי אירעו כאן. ישנו מדרש חז"ל המובא בפירוש רש"י על סנהדרין קא, ב ובמקומות אחרים: "אמר לו משה להקב"ה אתה הרעות לעם הזה שעכשיו אם אין להם לבנים משימין בניהם של ישראל בבנין". המגיב למד מדרש חז"ל זה בצמוד לפסוק "למה הרעתה לעם הזה" (שמות ו, ג) או בצמוד לפסוק "לך רד כי שחת עמך" (שמות לב, ז), שכח כי מדובר במדרש חז"ל, ורק זכר שלמדו יחד עם פסוקי התנ"ך. מכאן הדרך קלה ומהירה לומר ש"ככה לפי התנ"ך התעללו בתינוקות", ולא היא. "ככה לפי חז"ל התעללו בתינוקות". המגיב זכר פרשנות של גננת או של מורה לכך שערי המסכנות הן בעצם הפירמידות. מכאן הגיעה טעות נוספת. בעוד שבמדרש חז"ל כלל לא דיברו על פירמידות, ובתנ"ך הן בוודאי לא מוזכרות, לפי זכרון המגיב בתנ"ך נאמר במפורש ש"השתמשו בהם כלבנים בפירמידות". לסיכום, בתנ"ך לא נאמר שהשתמשו בתינוקות כלבנים. הדבר נאמר במדרשי חז"ל. אפילו במדרשי חז"ל לא נאמר שהשתמשו בתינוקות כלבנים בפירמידות אלא בבניין ערי המסכנות שדובר עליהן בתנ"ך. אביתר ג'שיחהתרומות • כ"א באלול ה'תשע"ג • 12:52, 27 באוגוסט 2013 (IDT).
א. ראשית, הבחנה, ולא אחרת.
ב. שנית, ההערה שלך מתייחסת רק לחלק מהבעיה, ולא העיקרי בה. הבעיה העיקרית היא זלזול מובנה בכל אמירה או קביעה שמקורה חוץ תורני, בין הוא מקראי או דרשני. אינני מדבר כאן על דעות שונות שהרי על אלה ניתן להתווכח, אלא זילות בעצם המשמעות של קיומם של ראיות, ממצאים ואף תוצאות מדידות, המחייבים אותנו להתייחס אליהם ברצינות. בנצי - שיחה 19:51, 27 באוגוסט 2013 (IDT)
א. צודק.
ב. צודק. מצד שני, באתי להעיר על נקודה אחרת. נכון ש-FireSky מזלזל בראיות ובממצאים ארכיאולוגיים ובמחקרים היסטוריים, אבל אפילו לשיטתו, אפילו בלי לקבל את נכונותם של כל האחרונים, הוא טועה. מה שהוא אמר שכתוב במפורש בתנ"ך אינו כתוב במפורש אפילו בדברי חז"ל. אביתר ג'שיחהתרומות • כ"ב באלול ה'תשע"ג • 13:04, 28 באוגוסט 2013 (IDT).

אירוע מוחי[עריכת קוד מקור]

כאשר נאבדת יכולת הדיבור בשבץ מוחי, האם אפר להחזיר אותה על ידי תרגול מסויים/תרופה מסויימת התהליך מור207 - שיחה 14:03, 19 באוגוסט 2013 (IDT)

ויקיפדיה אינה מספקת ייעוץ רפואי:
אני עונה מהידוע לי על מקרים כאלה: אם היכולת נעלמה כליל מתוקף מוות של הנוירונים באזור רלוונטיי, אז למיטב ידיעתי, זה, נכון להיום, בדרך כלל לא אפשרי על ידי תרופה, וודאי לא על תרגול, שכן מרגע שיש נקרוזה של התאים באזור \ גרעין מוחי הרלוונטי, התאים עצמם מתו והתפתחה שם רקמת צלקת (במערכת העצבים המרכזית אין לידה מחדש של תאים באופן כללי כמו בזו ההיקפית), והיות ואין תאים, אין גם עיבוד של מידע הקשור בשפה (כי אין תאים שיאחסנו ויעבדו את המידע), ואין גם אינטגרציה לאזורים מוטוריים שיוציאו אותו לפועל ברמה השרירית (כמו בעצבוב תיבת הקול, הפה, וכו'), ולכן, על פי הידוע לי, אין דרך לסייע במקרה כזה (כמובן שזה מקרה מאד נדיר שקורה בתאונות קשות מאד). מה שכן נחקר כבר 20 שנה בערך זה נושא של השתלות של רקמה מוחית, בהקשר של מחלת פרקינסון למשל. ההנחה היא שהשתלה של רקמות שונות תביא לכך שהן יתמיינו לנוירונים כמו אלו שיש בחומר השחור (Substantia Nigra) שהוא אזור שלרוב קשור לתנועה, בפרט ללקות התנועה האופיינית לפרקינסון. נראה היה שההשפעה של זה לא היתה מוחלטת וזה הוליד מחלוקת מחקרית לגבי עד כמה הטיפול הזה כשלעצמו אפקטיבי. ההשערה היא שהתנועה עצמה שנפגעת בפרקינסון קשורה גם לזיכרון המוטורי שנמצא בנוירונים עצמם ולא רק לנוירונים כגוף אנטומי, ואובדן הזיכרון הוא חלק אינטגרלי מהצלחת הטיפול, וזה לא מאד מספיק רק לשתול את רקמת הנוירונים החדשה שאין בה את הזיכרונות הללו. ייתכן שבעתיד כאשר יהיה קל יותר להנביט רקמות רלוונטיות במעבדה, יוכלו לשתול אותן באזור שנפגע וזה יוכל במידת מה לסייע, אבל גם אז זה יהיה כרוך בללמד את האדם לדבר מחדש (כי הרי בשביל שיהיה דיבור צריך שיהיה גם מידע תוך-נוירונאלי שיאפשר אותו). ‏Ben-Natan‏ • שיחה 14:56, 19 באוגוסט 2013 (IDT)
תודה רבה לך. עזר לי מאוד מור207 - שיחה 18:53, 19 באוגוסט 2013 (IDT)
יש לי שאלה על מקרה דומה. אדם שעבר אירוע מוחי או משהו דומה, והיה כמה זמן בשיקום, והיום הוא מתפקד כרגיל ברוב התחומים, אבל הוא מדבר מאוד לאט. מה גורם לכך? האם שרירי הפה זזים לאט? האם עיבוד הדיבור במוח עובד לאט? אם הוא יעבור לדבר בשפת סימנים במקום בפה, האם הדיבור יהיה מהיר יותר? אם הוא יכתוב במקום לדבר, האם זה יהיה מהיר יותר? 80.230.18.149 19:06, 19 באוגוסט 2013 (IDT)
נשמע שלדאבונינו, אדם זה חווה, בעקבות השבץ או התאונה, ניוון של גרעינים במערכת העצבים המרכזית המבססים את עצבי הגולגולת או לפחות את יכולת הפקת השפה. יכול להיות שהמדע הנוכחי מציע טיפולים שונים, אולי נסיוניים, שבהם ניתן יהיה לסייע לו נקודתית (כלומר בעניין הדיבור), אני חושב שזה כבר כל מקרה לגופו. ‏Ben-Natan‏ • שיחה 05:50, 20 באוגוסט 2013 (IDT)
תודה על התשובה. אני לא שואל על טיפולים. אני שואל, האם הפגיעה ביכולת הפקת השפה היא בגלל פגיעה במוטוריקה של שרירי הפה, או באופן עיבוד הדיבור במוח, או באופן כללי בתהליכים של עיבוד של תקשורת? 80.230.18.149 10:32, 20 באוגוסט 2013 (IDT)
אני לא יודע למה אתה בדיוק מתכוון ב"תהליכים של עיבוד תקשורת" לעיבוד תקשורת (או מסרים) יש עיבוד ברוב שטחו של המוח בגלל שהם נוגעים לאזורים גבוהים רבים מאד והם לווא דווקא "שפתיים" מבחינת שפה וורבאלית ידנית או אוראלית (אלא יכולים להיות גם, למשל, פרומונאלית). אני כן הייתי מדגיש את העניין של אזורי שפה, ואת המסילות שלהם אל אזורי מוטוריקה (כולל את אזורי המוטוריקה עצמם, המעצבבים איברים המשמשים להפקת שפה וורבאלית ידנית או אוראלית). בברכה. ‏Ben-Natan‏ • שיחה 13:26, 20 באוגוסט 2013 (IDT)
פעמים רבות שבץ מלווה בפגיעה במרכזי השפה והיא משמעותית יותר מפגיעה פשוטה במוטוריקה. לפגיעה כזו פנים רבות, ע"ע אפאזיה. יוסישיחה 23:42, 20 באוגוסט 2013 (IDT)

קורלציה בין שכר להשכלה[עריכת קוד מקור]

האם נמצא קשר בין השכלה לבין שכר חודשי בארץ? 109.65.154.132 16:20, 19 באוגוסט 2013 (IDT)

כן. ראה כאן, בפרט בלוח 9 שנמצא בעמוד 20. בלנק - שיחה 20:05, 19 באוגוסט 2013 (IDT)

הים הגדול ביותר[עריכת קוד מקור]

לפי חיפוש שעשיתי הים (מקווה מים מלוחים המחובר לאוקיינוס) הגדול ביותר מבחינת שטח הוא הים התיכון. האם זה נכון ומהם הימים הגדולים ביותר? מהי הימה (מקווה מים שלא מחובר לאוקיינוס) הגדולה ביותר? בברכה, MathKnight (שיחה) 17:40, 19 באוגוסט 2013 (IDT)

אני לא יודע לגבי ים, אבל אני חושב שימת באיקל היא הגדולה בעולם או לפחות אחד הגדולים. גילגמש שיחה 17:43, 19 באוגוסט 2013 (IDT)
טעות, ראיתי שלפי מה שכתוב בערך ים סין הדרומי (שהוא השני בגודלו) הים הכי גדול הוא הים הערבי עם שטח של 3.8 מיליון קמ"ר. בברכה, MathKnight (שיחה) 17:48, 19 באוגוסט 2013 (IDT)
מה עם ים האלמוגים? 4.8 מיליון קמ"ר. ♠ גיל כ. (שיחה) ♠ 17:56, 19 באוגוסט 2013 (IDT)
צודק. אם כך בערך ים סין הדרומי יש טעות שצריך לתקן. בברכה, MathKnight (שיחה) 19:07, 19 באוגוסט 2013 (IDT)
אולי עדיף שהמידע לגבי הים הגדול ביותר יופיע בערך ים האלמוגים או בערך הים הערבי, ולא בערך ים סין הדרומי? 80.230.18.149 19:25, 19 באוגוסט 2013 (IDT)
לאו דווקא יש טעות. השאלה מה היא "גדול" לצורך העניין הזה. הכי עמוק? בעל שטח הפנים הגדול ביותר? בעל הנפח הגדול ביותר? בעל החופים הארוכים ביותר? השאלה לא מוגדרת היטב. גילגמש שיחה 19:27, 19 באוגוסט 2013 (IDT)
נראה שים האלמוגים גדול מהים הערבי גם בנפח. אותי מעניין גודל מבחינת שטח. בברכה, MathKnight (שיחה) 19:37, 19 באוגוסט 2013 (IDT)

כמה מההחייאות מצליחות (באחוזים)?[עריכת קוד מקור]

כמה אחוזים מסך כל ההחייאות הם של החייאות מצליחות? 176.13.161.70 18:47, 19 באוגוסט 2013 (IDT)

קודם כל, חשוב לציין שהחייאה לבדה, ללא טיפול תרופתי וללא שוק חשמלי (שנועד למקרה של פרפור חדרים) כמעט לעולם אינה "מצליחה". כלומר- כמעט אף פעם אין חזרת דופק ספונטנית בעקבות החייאה בלבד. מטרתה העיקרית היא לשמר סוג של מחזור דם עד להגעתה של ניידת טיפול נמרץ או עד להגעה לבית חולים. כך נמנע מוות של הרקמות, שהופך את המצב לבלתי הפיך. לעצם השאלה: כ-5-10 אחוז מהחולים שעוברים החייאות שורדים, וחלק ניכר מהם שורדים בתור צמחים, משותקים, וכד'. בלנק - שיחה 19:28, 19 באוגוסט 2013 (IDT)

בערך CPR האנגלי יש מידע סטטיסטי בנושא- עם חלוקות שונות. 176.13.161.70 23:50, 19 באוגוסט 2013 (IDT)

לב וכלי דם[עריכת קוד מקור]

האם אפשר לומר שלכל המיתרניים יש לב וכלי דם? אם לא, האם אפשר לומר זאת על קבוצת על אחרת? בתודה, אלירן d שיחה 23:15, 19 באוגוסט 2013 (IDT)

על פי הערך לב בויקיפדיה האנגלית, הלב משותף לבעלי חוליות. ניסיתי מאוד למצוא איזה שהוא מיתרני בלי לב ולא הצלחתי. אז אולי אפשר להכליל יותר. נראה שיש אפילו בעלי חיים ממערכות אחרות יש להם לב ו/או כלי דם.בלנק - שיחה 23:47, 19 באוגוסט 2013 (IDT)
אכן על פי המאמר הזה לכל המיתרניים יש לב וכלי דם. בלנק - שיחה 23:53, 19 באוגוסט 2013 (IDT)
איזה מענה מהיר, תודה! ברשותך, אעלה שלב: "גוף מדוזת הסוכך הוא בצורת פעמון. מבנה המדוזה בסיסי ביותר: היא חסרת ראש, סנפירים או לב (לכן אינה נחשבת לדג) ובמקום מוח יש לה רשת עצבים ראשונית בלתי מפותחת". האם מדוזה היא מיתרנית או שהיא ממערכה אחרת? אם כן, איזו? בנוסף, לכל המיתרניים יש מיתר גב, אבל רק לבעלי גולגולת יש מוח (כמדומני). הכיצד? אלירן d שיחה 01:10, 20 באוגוסט 2013 (IDT)
אוי, רק עכשיו ראיתי: המדוזה אינה מיתרנית כי אם צורבת. אלירן d שיחה 01:14, 20 באוגוסט 2013 (IDT)
אמקד: מה שאני לא מבין זה איך יכולה להיות מערכת עצבים ו/או עמוד שדרה בלי שיהיה מוח. אלירן d שיחה 01:22, 20 באוגוסט 2013 (IDT)
השאלה שלך נובעת מראיה של התוצאה הסופית, הכוללת, המקבלת את קיומו של המוח כדבר נתון. אין זה כך. חלקי המוח השונים הם תוצאה של התפתחות אבולוציונית, וככל שהחלק במוח מורכב יותר, כך הוא 'צעיר' יותר מבחינה אבולוציונית. כלומר, מערכת עצבית, כלשהי, קדמה למוח. בקווים כלליים וגסים, הסיפור מתחיל בהתפתחות של צינור עצבי, בהתעבותו ובהצטופפות תאיו ובהתמיינותם. מכאן להתפתחות עמוד השדרה, ומחלקו להתפתחות המוח המוארך, המצוי בבסיס המוח האנושי לדוגמא, והוא הפרימיטיבי ביותר. כך גם עם מרכזי מוח מורכבים יותר, ולכן מאוחרים יותר. עיין ב-9 השורות הראשונות בסעיף זה מתוך 'מוח'. בסיכום, המוח המפותח, המפקח, הוא תוצר של התפתחות אבולוציונית, ולא חלק ראשי של מערכת נחמדה המוזמנת מראש על כלל מרכיביה, דוגמת מכונית או מחשב או טכנולוגיות בכלל, בהם לא ניתן לדבר על מכונית ללא מנועה, או על מחשב ללא המעבד שלו. בנצי - שיחה 11:20, 20 באוגוסט 2013 (IDT)
תודה, בנצי. אני חשבתי שיצורים ללא מוח, המידע אצלם פשוט עובר מנוירון אחד למשנהו בלי להגיע למקום שמארגן אותו, וכתוצאה מכך כל הפעולות שלהם הן בעצם רפלקס. בכל זאת, מדוזה, שאין לה מוח, יכולה... לחשוב? ללמוד? לבצע שני דברים בו-זמנית? איפה ההבדל בין יצורים בעלי מוח ליצורים חסרי מוח בא לידי ביטוי? אלירן d שיחה 15:23, 20 באוגוסט 2013 (IDT)
כמו שאמרת, מדוזה שאין לה מוח תפעל רק על ידי רפלקסים, ולכן לא תוכל ממש לחשוב או ללמוד. (לחשוב- אם תשאל אותי גם יתוש לא יכול.) אם תסתכל על גזע המוח ועל המוח הקטן של בני אדם תראה שגם בהם לא מתרחש ממש תהליך חשיבה. בלנק - שיחה 18:38, 20 באוגוסט 2013 (IDT)

על מחשב ועל טירוף מערכות[עריכת קוד מקור]

תוך כדי עבודה עם כמה וכמה דפי רשת פתוחים, חלקם ממוזערים, החליט המחשב שלי לזרוק את כולם (מלבד אחד), תוך כדי ניסיון שלי לפתוח דף רשת חדש, והותיר אותי חסר אונים לגמרי. הישנה דרך לשחזר או לאחזר את הדפים שהיו פתוחים עד לאירוע זה (אני עובד עם אקספלורר, ולמי ששואל - כן, עדיין) ? תודה, בנצי - שיחה 01:18, 20 באוגוסט 2013 (IDT)

אפשר לשחזר לשוניות דפדפן שנסגרו באמצעות לחיצה על CTRL+SHIFT+T. ייתכן שהלשוניות נסגרו בטעות אם סמן העכבר היה עליהם, ולחצת על הכפתור האמצעי בעכבר (כפתור הגלילה). ראה הסברים וקיצורים נוספים באתר נקסטר מקבוצת מאקו. -- הודעה זו הושארה על ידי אנונימי/ת
אם רק יורשה לי, אחד מהמאפיינים הבולטים של גוגל כרום הוא טיפול ספיציפי בבעיה הזו. קובי כרמל - שיחהויקיפדיה היא אנציקלופדיה • 06:13, 20 באוגוסט 2013 (IDT)
זה לא יועיל לך, אבל, כשפיירפוקס קורס, הוא אומר משהו כמו "אופס קרסתי, אלו הדפים שהיו פתוחים, אתה רוצה לשחזר אותם?" (ואז יש רשימה שאתה יכול לבחור את כולה או חלקה). הוא עושה את זה, גם אם יש הפסקת חשמל והתכונה הזאת קיימת כבר שנים רבות. בכרום יש פיצ'ר דומה, אם כי פחות נגיש למיטב זכרוני. לגביי אקספלורר מסתבר שיש את [2]. בברכה, --איש המרק - שיחה 09:37, 20 באוגוסט 2013 (IDT)
הפעולה של הפיצ'ר בכרום היא זהה. היתרון המוסף שיש בכרום הוא בכך שכאשר מתרחשת הקריסה, היא תתרחש אך ורק בכרטיסיה אחת. שאר הכרטיסיות יוכלו להמשיך ולתפקד כרגיל. קובי כרמל - שיחהויקיפדיה היא אנציקלופדיה • 10:01, 20 באוגוסט 2013 (IDT)
ואם כל זה לא הועיל, Ctrl-H מביא רשימת היסטוריה על פי ימים (החדשים קודם). הפיקנופודיה טובה ממך! אילן שמעוני, - שיחה 13:34, 20 באוגוסט 2013 (IDT)

סתירה בערך רקמת תאים?[עריכת קוד מקור]

האם אפשר בבקשה לקבל הסבר לסתירה בערך רקמת תאים בויקיפדיה ששם כתוב כך:

בגופי יצורים מורכבים קיימים ארבעה סוגי רקמות עיקריים: רקמת עצב, רקמת שריר, רקמת אפיתל ורקמת חיבור. המונח רקמה מתייחס בלעדית ליצורים רב-תאיים, שכן רק בהם קיימים סוגים רבים של תאים. בגוף האדם, למשל, קיימים 260 סוגי רקמות.

? מצד אחד כתוב שיש ארבעה סוגי רקמות ומצד שני כתוב שיש 260 סוגי רקמות. בנוסף לכך כתוב שיש סוגים רבים של תאים אני מכיר בערך 15 סוגי תאים (לרבות תאי דם לבנים על נגזרותיהם שהם שבעה) אני מבולבל לגמרי ואשמח לקבל הסבר. תודה. 176.13.161.70 01:20, 20 באוגוסט 2013 (IDT)
א' שים לב למילה עיקריות. ב', אני לא יודע כמה רקמות יש בדיוק וזה תלוי מאד איך מגדירים רקמה, קח למשל את המונח נוירון. כל פעם מתגלים סוגים חדשים של רקמות מזעריות ביותר של נוירונים שעושים פעולה עצבית אחרת בתכלית. קבוצה נוירונאלית אחת בקורטקס הויזואלי מטפלת בעיבוד קווי מתאר (למשל) של תמונות המתקבלות מהעין ברמת השלם (כלומר, כחלק מה"תמונה" השלמה), שנייה עוסקת בקווי המתאר בתנוחה מסוימת, שלישית עוסקת בקווים שהם בתנוחה מסוימת ובתנועה וכו'. קבוצה רביעית בקורטקס זה (שרק בו בעצמו סביר לי להניח שיש, לפי הגדרה, סוגים רבים של רקמות והרי קח בחשבון שכל יום ייתכנו תגליות חדשות בהקשרו) שעוסקת למשל בפרשנות הצבע של שבריר התמונה המתקבל מפוטון מסוים הנקלט ברשתית. ועד כה רק דיברתי איתך על הקורטקס הויזואלי, ישנם אזורים המופעלים בעת חישוב מתמטי באזורים כגון (Intra-Parietal sulcus, או Angular Gyri), ויש אזורים כלליים הקשור להבנת שמע, הפקת שמע, והרשימה ארוכה מאד. זה היה כדי להראות לך שיש לקרוא בביקורתיות רבה טענות נחרצות אודות "מספר הרקמות" באורגניזמים בכלל והאנושי בפרט ו"הבנייה" של רקמות תלויה גם ברזולוציה שאליה אתה מוכן לרדת מבחינת תפקיד התצורה האנטומית (למשל), ולא רק איך שהיא נראת במיקרוסקופ. ‏Ben-Natan‏ • שיחה 05:47, 20 באוגוסט 2013 (IDT)
הפרדה לסוגי רקמות היא מבנית ולא פונקציונלית (כמו שאפשר להבין מהתגובה הקודמת). למיטב זכרוני, בערך אפיתל יש כמה דוגמאות לסוגי אפיתל עיקריים, שאני מניח שאפשר שגם בתוך תתי סוג אלו יש הבדלים באזורים שונים בגוף. יש גם שרירים שונים, בלוטות ועוד. בטח יותר מ-4 סוגים. לגבי 260, כדאי לשאול את מי שכתב את זה. יוסישיחה 23:33, 20 באוגוסט 2013 (IDT)

סתירה בערך כוכבן קוצני?[עריכת קוד מקור]

בערך כוכבן קוצני בויקיפדיה כתוב כך: "מערכת איברי הרבייה של הכוכבן היא מחומשת (כמו של שאר כוכבי הים). לכוכבן חמישה פתחי רבייה, נקבים זעירים הנמצאים בבסיס הזרועות. מספר איברי הרבייה הוא כפול ממספר הזרועות." כמה איברי רבייה יש לכוכבן? 80.230.18.149 10:42, 20 באוגוסט 2013 (IDT)

10, אם הבנתי נכון. הניסוח די מעורפל אך כנראה שהכוונה שבכל זרוע יש מערכת רבייה ובו שני איברי רבייה. אני לא בטוח שזו האמת. -יונה בנדלאק - שיחה 12:29, 20 באוגוסט 2013 (IDT)

djvu[עריכת קוד מקור]

איך פותחים קובץ כזה ואיך אפשר להמיר אותו ל-PDF רגיל. גילגמש שיחה 13:05, 20 באוגוסט 2013 (IDT)

כנ"ל קובץ epub. גילגמש שיחה

אתה יכול להוריד את djvu reader ואת epub reader - חפש בגוגל. אתה יכול גם לחפש בגוגל "convert djvu to pdf" וכו', ושוב יש לך תוצאה ראשונה בגוגל. בלנק - שיחה 13:21, 20 באוגוסט 2013 (IDT)
תודה גילגמש שיחה 14:38, 20 באוגוסט 2013 (IDT)

מקורו של העולם[עריכת קוד מקור]

האם היצירה מקורו של העולם נועדה להיות מושכת מבחינה מינית? היא גורמת לי לרתיעה בעיקר. האם זה בא מכך שאני מסכל בעיניים של היום (כשהיום אפשר למצוא צילומי עירום בכל מקום) ולכן אני לא מתרשם מהארוטיקה? אני די נדחה מלראות את היצירה- האם זאת הייתה המטרה של היוצר, או שזו הבעיה שלי? 79.177.139.120 15:37, 20 באוגוסט 2013 (IDT)

התמונה אכן ריאליסטית מאוד, ובעיני רבים אינה מושכת מינית.
למעשה, זו גדולתה כיצירת אומנות. שמו של הציור, שאותו בחר האמן עצמו, הוא חלק מהעניין. זהו ציור גדול (כחצי מטר) של עירום מופגן, ריאלסטי בצורה מעוררת השתאות, המותיר את הצופה פעור-פה והמום (ואולי אף מעט נגעל), להירהורים - מה הוא ריאליזם באומנות, ומה הוא באמת מקורו של העולם.
ובתשובה לשאלתך - אמנם איננו יכולים לקבוע בפסקנות מה הייתה כוונת האומן, אך כפי שניחשת, סביר שה"אירוטיקה" היא לא העניין כאן. בברכה, דני. Danny-wשיחה 16:05, 20 באוגוסט 2013 (IDT)
א. אֹמן, בלי ו'. אומן זה משהו אחר. בנצי - שיחה 17:17, 20 באוגוסט 2013 (IDT)
ב. מסכים עם החלק הראשון בדבריך, ועם חלקם האחרון. לגבי שם היצירה - הוא עורר בי התנגדות עזה והתקוממות פנימית. עם כל הכבוד לאדם ולאנושות, הם עדיין לא 'העולם' ! בנצי - שיחה 17:17, 20 באוגוסט 2013 (IDT)
״העולם הוא שם לתיאור הציוויליזציה האנושית, וספציפית ההתנסויות, המצב וההיסטוריה של בני האדם על פני כדור הארץ״ מתוך הערך עולם. 46.19.80.235 22:06, 20 באוגוסט 2013 (IDT)

היווצרות החיים[עריכת קוד מקור]

בבקשה, בלי תשובות דתיות ובריאתניות- זה לא השירשור הנכון.

איך המדע מסביר היווצרות של יצור חי (כנראה "חד תאי" מאוד פרימיטיבי) מחומרים שהיו בכדור הארץ בזמנו?

במה שונים התנאים היום, שלא נוצרים חד תאיים פרימיטיביים באופן ספונטני?

אילו תנאים היו שאי אפשר לשחזר במעבדה? הזמן שהתהליך לוקח אינו קריטריון- זה לא שהתהליך לקח הרבה זמן. זה עניין סטטיסטי של כמות ניסויים עד להצלחה ראשונה. 109.64.151.185 16:29, 20 באוגוסט 2013 (IDT)

ראה ערך בריאה ספונטנית. ‏Hyuna‏ • שיחה • חציל-צילון • 16:31, 20 באוגוסט 2013 (IDT)
וגם מוצא החיים וניסוי מילר-יורי. בלנק - שיחה 18:34, 20 באוגוסט 2013 (IDT)
השינוי המשמעותי ביותר מבחינת סביבה ותנאים, היא היווצרותו של חמצן מולקולרי עקב פעילותם הפוטוסינתטית של יצורים תאיים ראשוניים, שכבר פיתחו יכולת פיזיקלית-ביוכימית זו (גז חיוני לחיים זה היה קיים באטמוספרה קודם לכן, במידה זניחה לגמרי). בלעדי התפתחות מכרעת זו, כל השלבים הבאים של הענפים האבולוציוניים שהובילו ליצורים עילאיים יותר לא היו אפשריים. בנצי - שיחה 13:17, 21 באוגוסט 2013 (IDT)
תודה על ההתייחסות. בבקשה אל תתקן את ההודעה שלי בלי שהתבקשת. אם ירדתי שורה אחרי כל תת-שאלה, אז כך התכוונתי לעשות. 109.64.151.185 13:34, 21 באוגוסט 2013 (IDT)
א. המרחב כולו פתוח לעריכה, ולא תמיד יש צורך בנפח שאלה גדול, מעבר לתוכן עצמו. לכן הבקשה היא בעצם הפוכה, ואני מקבל אותה. עם זאת, חבל שהחזרת את הגירסה המקורית מבלי לנצל את ההזדמנות להגיה אותה - למשל, שני המקפים שם שגויים, ומקף אינו תחליף לפסיק או לנקודותיים.
ב. מה שחשוב הוא גופה של שאלתך. מצאתי לנכון להתייחס לתפנית חשובה במיוחד, ואני מקווה שנתת את דעתך לכך. בנצי - שיחה 16:00, 21 באוגוסט 2013 (IDT)
שאלה בלשון (לא בשביל להתווכח): מה רע במקפים שהאנונימי כתב? האם באמת עדיף שם פסיק? 80.230.25.232 17:39, 25 באוגוסט 2013 (IDT)
אולי הסרטונים האלו יעזרו לך: אביוגנזה מוסברת בפשטות. --‏Manedwolf‏ • שיחה 16:42, 21 באוגוסט 2013 (IDT)

אפשר דוגמאות לאיברים שמורכבים מסוגים שונים של רקמות?[עריכת קוד מקור]

אפשר לקבל דוגמאות לאיברים שמורכבים ממספר רקמות וגם לרקמות שמורכבות מסוגים שונים של תאים? 176.13.161.70 19:39, 20 באוגוסט 2013 (IDT)

יד, מכילה גם רקמות שריר וגם רקמות עצם. הדם מוגדר כרקמת חיבור ומכיל תאי דם מסוגים שונים. Uziel302 - שיחה 22:22, 20 באוגוסט 2013 (IDT)
היד מכילה גם עור ועצבים, בנוסף לשרירים, לעצמות ולדם.
האוזן מכילה איברים אחדים, שכול אחד מהם מכיל עצמות, עצבים ואפיתל..ודם.
יש לי שאלה הפוכה. מי מכיר בגוף האדם, קטע גוף, שמקובל לכנות "איבר" ויש בו רק רקמה מסוג אחד? (בשן יש עצם ועצב ואת העור לבדו, או את השיער או הציפורן, קצת קשה לכנות "איבר"). עִדּוֹ - שיחה 22:59, 20 באוגוסט 2013 (IDT)
עידו, כדאי שנתחיל בשיטת האלימינציה וכדי לחסוך חיפושים נתחיל לחפש מקומות שהדם לא עובר בהם... (הדם רקמת חיבור) אחרת הלב מכיל רק רקמה אחת מיוקרדיום. 95.35.232.184 00:35, 21 באוגוסט 2013 (IDT)

מה זה אלל באנטומיה?[עריכת קוד מקור]

קראתי את הערך רקמת חיבור, ובתוכו מצוין שרקמת חיבור צפופה "נמצאת בגידים, ברצועות, באלל (אפונוירוזה), בקרנית, בקרום הקשה ובגלימה הלבנה באשכים." המילה "אלל" מסומנת שם באדום, כלומר שאין לה ערך בויקיפדיה העברית. ניסיתי לחפש מידע על החלק האנטומי הזה בגוגל ולא כל כך מצאתי... אפשר להסביר לי בינתיים - עד שהערך ייכתב- מה זה אלל באנטומיה? (לפי מיטב הבנתי לא מדובר על אַלֶל (allele) מתחום הגנטיקה)95.35.232.184 20:56, 20 באוגוסט 2013 (IDT)

אינני מבין בנושא, אבל מבדיקה במאגר המונחים של האקדמיה ללשון, מתברר שאָלָל הוא החלופה העברית התקנית למונח aponeurosis. תוכל למצוא מידע עליו בוויקיפדיה האנגלית. ‏nevuer‏ • שיחה 21:19, 20 באוגוסט 2013 (IDT)

סניפי בנקים זרים בארץ[עריכת קוד מקור]

א. אני מניח שיש כאלה. מישהו יודע איזה ?

ב. האם אזרח ישראלי מן השורה יכול לפתוח חשבון פעיל בסניפים כאלה ? תודה, בנצי - שיחה 13:17, 21 באוגוסט 2013 (IDT)

לא מומחה אבל יש לי גוגל [3] ‏[. kotz]‏ [שיחה] 14:55, 21 באוגוסט 2013 (IDT)
אכן אתר מכובד ביותר, ועתיר קישורים. מעניין, חיפושים קודמים שלי לא העלו אותו. תודה. בנצי - שיחה 16:32, 21 באוגוסט 2013 (IDT)
Citibank בתל אביב, HSBC Bank plc כנ"ל, SBI State Bank בר"ג, אלאסכאן אלאורדוני באום אל פחם, בנק אלקהירה- עמאן בירושלים, ועוד הרבה בשטחי הרש"פ. חזרתישיחה 20:51, 21 באוגוסט 2013 (IDT)

שיחות טל' פולשניות מצד מוסדות חרדיים[עריכת קוד מקור]

לאחרונה, וביחוד לפני החגים הגדולים (תשרי וניסן במיוחד), נכנסות שיחות הן בקווי והן בסלולארי, עם הודעות מוקלטות מצד גופים דוגמת הרב איפרגן ו'מוסדות התנא הקדוש', וממסיינות. דומני שגישה חופשית שכזו למכלול בתי האב במדינה אינה חוקית. איך הם מגיעים למס' של כולנו ? האם משרד התקשורת מתיר זאת ? יש למי להתלונן בעניין ? בנצי - שיחה 18:15, 21 באוגוסט 2013 (IDT)

יש חוק נגד ספאם. נראה לי שאפשר לתבוע גם על שיחות טלפון פרסומיות. גילגמש שיחה 18:27, 21 באוגוסט 2013 (IDT)
ראה כאן, זכרתי שהתפרסם בדיוק לפני כמה ימים אז חיפשתי ומצאתי NiD123 - שיחה 23:25, 21 באוגוסט 2013 (IDT)
א. קראתי את הכתבה אליה הפנית. מאוד מרגיז. מדובר בתעשיית כספים שרלטנית ומכוערת. הבעיה אינה בעצם הטענה שאין מדובר בפירסום מסחרי, אלא בחוסר ההבחנה או הבקרה בין מה שכן מסחרי ובין מה שלא. כלומר, במה שעניין 'דתי' יקרא, גם לכאורה, לא נוגעים. חלק ניכר מהאשם תולה בבורותם של רבים בציבור החילוני, ובהם פוליטיקאים ומקבלי החלטות למיניהם, המקבלים באופן גורף כל מה שמגיע מאותם שרלטנים, במין 'חרדת קודש' הבאה לחפות על אי-ידיעתם שלהם, או אף ממקום של אמונה פונדמנטליסטית שאין לה שום קשר לאורח החיים שלהם עצמם, ומבלי שיהיו להם כלים תודעתיים-אורייניים בסיסיים כדי להבחין בין עיקר לטפל.
ב. חלק מהמסרים לא מדבר דווקא על תרומות (ואולי כן, לא הקשבתי עד הסוף), על החינוך ה'ייחודי' שהם מציעים, שיש בו תשובות מופלאות לכל בעיות החינוך הקיימות במגזרים אחרים. זה עוד יותר מקומם. בנצי - שיחה 10:44, 22 באוגוסט 2013 (IDT)
אם הדבר כל כך מציק לך, התייעץ עם עו"ד. יתכן שבית המשפט יפרש את כהטרדה או משהו כזה. גילגמש שיחה 10:49, 22 באוגוסט 2013 (IDT)
איפה אפשר למצוא רשימות של מספרים לחסימה? (ולא אכפת לי לחסום קצת יותר מדי. מי שיפגעו יהיו מי שמספקים להם את השרותים). Tzafrir - שיחה 20:49, 22 באוגוסט 2013 (IDT)
מה מרגיז בזה? אני הרב הקדוש ואתה צריך לתת לי כסף. אין לך זכות להתרגז. אלוהים יכה אותך אם תכעס עלי. קדימה, פתח את הארנק, לפני שאני אסדר לך טקס פולסה דה שמולסה. עִדּוֹ - שיחה 11:13, 23 באוגוסט 2013 (IDT)
אני מקבל בדרך כלל שיחות מקבר רחל, זה נחשב לרמיזה שהזמן שלי מתקרב? 79.182.115.203 12:39, 24 באוגוסט 2013 (IDT)

אתר ברשת המאפשר בדיקה[עריכת קוד מקור]

או התעדכנות לגבי סטטוס 'עיכוב יציאה מהארץ'. האם מישהו מכיר את האתר הזה ? תודה, בנצי - שיחה 18:18, 21 באוגוסט 2013 (IDT)

תוצאה ראשונה בגוגל: לקבלת מידע על עיכוב או מניעת יציאה מהארץ יש לחייג 3450*. ‏Ovedcשיחהאמצו ערך יתום! 10:59, 22 באוגוסט 2013 (IDT)
לא, את זה, או משהו דומה, ראיתי. מדובר באתר בו אתה מקליד את מס' הזיהוי שלך, ומקבל סטטוס. בנצי - שיחה 00:16, 23 באוגוסט 2013 (IDT)

למה טיפשות מרגיזה?[עריכת קוד מקור]

מדוע זה נורא מרגיז לשמוע בן אדם מדבר שטויות? זה לא רק אני: גם אנשים אחרים ששומעים מישהו דוחף הבלים בהבעה חכמה מיידית ירגיש בצורך לתקן אותו. למה זה? 79.182.115.203 11:44, 22 באוגוסט 2013 (IDT)

סיבה אחת היא שלהסביר לצד השני למה הוא טועה זה דבר שמצריך "לבזבז" אנרגיה מנטאלית, לפעמים לא מעט... לצערנו המוח האנושי של דורינו, בהמון מקרים אוטומטית רואה בזה דבר מעצבן, ונוטה שלא לעשות סינונים רבים בנושא. היכולת להישאר נינוח במקרים כאלה ולנסח הסבר תמציתי ולעתים גם פשטני ולקוני בכדי להסביר לאותו אדם שדיבר ב"טיפשות" למה הוא טועה היא סגולה משובחת ואצילית. סיבה נוספת שאוכל לציין היא נגזרת של הסיבה שציינתי: אפשר שכל מיני מחשבות כגון "מה יהיה אם הוא לא יבין" יקפצו לתודעת המאזין שמתיימר להסביר לדובר את טעותו. מחשבות כאלה בעצמן יכולות לעתים לגרום לאי נוחות או להגביר אי נוחות ותסכול קיימים. אני מניח שייתכנו עוד סיבות. ‏Ben-Natan‏ • שיחה 13:13, 22 באוגוסט 2013 (IDT)
אתה מתייחס רק למצב של שמיעה בלתי אמצעית עם אפשרות תגובה. ברוב המקרים זה לא המצב (לפחות בימינו שיש מערכות תקשורת המלאות הבלים...) לדעתי כשאדם שומע או קורא טענה הוא מנסה להבין אותה ולהזדהות איתה וכאשר הוא מגלה שהדברים שקריים או חסרי היגיון הוא מרגיש דיסוננס כלשהו.Uziel302 - שיחה 21:43, 22 באוגוסט 2013 (IDT)
שימו לב שהתרגזות היא רק אחת מהתגובות לטיפשות. למשל: הטיפשות של הומר סימפסון דווקא מצחיקה, והטיפשות של פורסט גאמפ דווקא נוגעת ללב. בלנק - שיחה 02:14, 23 באוגוסט 2013 (IDT)
כשטיפש מנהל את העניינים שלך, או מנסה לנהל אותם, זה מרגיז. זה מרגיז כי הוא מקלקל לך. עִדּוֹ - שיחה 11:11, 23 באוגוסט 2013 (IDT)

קברים של פעם[עריכת קוד מקור]

"ברוסיה התגלו חפירות של קברים מלפני כ- 30,000 שנה. האדם הקבור הוא גבר כבן חמישים, והשלד מעוטר בכ-3,000 חרוזים משנהב ממותות ותכשיטים אחרים משנהב ממוטות, והוא לבש כובע המעוטר בשיני שועל" [4]. לאיזה ממצא הכוונה ואם יש תמונות אז בכלל טוב. חן חן ‏[kotz]‏ [שיחה] 12:16, 22 באוגוסט 2013 (IDT)

הכוונה כנראה לאתר בשם Sungir, ראה תמונת וקצת מידע כאן. Reuveny - שיחה 15:27, 22 באוגוסט 2013 (IDT)
תודה! ‏[kotz]‏ [שיחה] 21:22, 22 באוגוסט 2013 (IDT)

גזע כלבים[עריכת קוד מקור]

אני מחפש את השם של גזע כלבים אחד. אני אתאר איך הוא נראה: קטן, שחור עם פרצוף מעוך (כלומר בלי לסטות בולטות קדימה) והתכונה הכי בולטת: קשיי נשימה כבדים- שומעים אותו מנשף מהר מאוד וכבד גם כשהוא פשוט הולך ברחוב. מישהו מזהה על מה אני מדבר?79.182.115.203 16:42, 22 באוגוסט 2013 (IDT)

נסה לחפש לפי הערך הזה: קבוצות הפדרציה הבינלאומית לכלבנות. תעבור על הקטגוריות אולי תמצא את הגזע הזה. גילגמש שיחה 20:03, 22 באוגוסט 2013 (IDT)
נשמע כמו פאג שחור, או בולדוג צרפתי שחור.-- הודעה זו הושארה על ידי אנונימי/ת

ײַ[עריכת קוד מקור]

לחיצה ממושכת על האות י׳ במקלדת הסמארטפון הובילה לקבלת הסימן הזה: ײַ מה המשמעות שלו בעברית? -- הודעה זו הושארה על ידי אנונימי/ת

זהו סימן ביידיש, שנהגה ay, להבדיל מ-יי שנהגה ey.-- הודעה זו הושארה על ידי אנונימי/ת

גלות החרש והמסגר[עריכת קוד מקור]

שלום, חיפשתי מידע על גלות החרש והמסגר. החיפוש באתר הוביל אותי לערך של א' בטבת שם מצויין שנה עברית כלשהי כתאריך, שלפי הלוח היוליאני בין 462 ל362 לפנה"ס. אין לי מושג על מה זה מתבסס, כי בערך יהויכין כתוב שעל סמך תעודות בבליות זה מתוארך ל597-. האם זה נובע מפער בין הלוח היוליאני לגרגוריאני? האם יש מקום להעיר משהו בנידון בערכים הנ"ל? -- הודעה זו הושארה על ידי אנונימי/ת

אני לא יודע מה היא גלות החרש והמסגר, אבל הפער בין הלוח היוליאני ללוח הגרגוריאני הוא ימים אחדים ולא שנים רבות. גילגמש שיחה 20:01, 22 באוגוסט 2013 (IDT)
ייתכן שהתאריך בא' בטבת מבוסס על המסורת היהודית ולא על המחקר כמו בערך יהויכין? -- הודעה זו הושארה על ידי אנונימי/ת
כן, דבר כזה יכול להיות באופן עקרוני. כמו שאמרתי, אני לא מכיר את האירוע שאתה מתכוון אליו, לכן לא יכול להתייחס בצורה פרטנית יותר. יתכן שלאירוע זה יש שם נוסף, מקובל יותר במחקר ונפו(ץ)ץ יותר ואני מכיר אותו. גילגמש שיחה 20:47, 22 באוגוסט 2013 (IDT)
יהויכין#גלות יהויכין. -- הודעה זו הושארה על ידי אנונימי/ת
ח בֶּן-שְׁמֹנֶה עֶשְׂרֵה שָׁנָה, יְהוֹיָכִין בְּמָלְכוֹ, וּשְׁלֹשָׁה חֳדָשִׁים, מָלַךְ בִּירוּשָׁלִָם; וְשֵׁם אִמּוֹ, נְחֻשְׁתָּא בַת-אֶלְנָתָן מִירוּשָׁלִָם. ט וַיַּעַשׂ הָרַע, בְּעֵינֵי יְהוָה, כְּכֹל אֲשֶׁר-עָשָׂה, אָבִיו. י בָּעֵת הַהִיא--עלה (עָלוּ) עַבְדֵי נְבֻכַדְנֶאצַּר מֶלֶךְ-בָּבֶל, יְרוּשָׁלִָם; וַתָּבֹא הָעִיר, בַּמָּצוֹר. יא וַיָּבֹא נְבֻכַדְנֶאצַּר מֶלֶךְ-בָּבֶל, עַל-הָעִיר; וַעֲבָדָיו, צָרִים עָלֶיהָ. יב וַיֵּצֵא יְהוֹיָכִין מֶלֶךְ-יְהוּדָה, עַל-מֶלֶךְ בָּבֶל, הוּא וְאִמּוֹ, וַעֲבָדָיו וְשָׂרָיו וְסָרִיסָיו; וַיִּקַּח אֹתוֹ מֶלֶךְ בָּבֶל, בִּשְׁנַת שְׁמֹנֶה לְמָלְכוֹ. יג וַיּוֹצֵא מִשָּׁם, אֶת-כָּל-אוֹצְרוֹת בֵּית יְהוָה, וְאוֹצְרוֹת, בֵּית הַמֶּלֶךְ; וַיְקַצֵּץ אֶת-כָּל-כְּלֵי הַזָּהָב, אֲשֶׁר עָשָׂה שְׁלֹמֹה מֶלֶךְ-יִשְׂרָאֵל בְּהֵיכַל יְהוָה, כַּאֲשֶׁר, דִּבֶּר יְהוָה. יד וְהִגְלָה אֶת-כָּל-יְרוּשָׁלִַם וְאֶת-כָּל-הַשָּׂרִים וְאֵת כָּל-גִּבּוֹרֵי הַחַיִל, עשרה (עֲשֶׂרֶת) אֲלָפִים גּוֹלֶה, וְכָל-הֶחָרָשׁ, וְהַמַּסְגֵּר: לֹא נִשְׁאַר, זוּלַת דַּלַּת עַם-הָאָרֶץ. -- הודעה זו הושארה על ידי אנונימי/ת

מה יותר משתלם להיות, עצמאי או שכיר?[עריכת קוד מקור]

מה השיקולים שצריכים להיות לי אם אני רוצה לבחור בין אם להיות עצמאי או שכיר? הבנתי שעצמאי לא מקבל פנסיה בעוד ששכיר כן מקבל, וחוץ מזה יש עוד הרבה זכויות שעצמאי לא מקבל. 46.210.149.99 20:12, 22 באוגוסט 2013 (IDT)

תגיד לי אתה מה עדיף, לקבל משכורת כשכיר של עשרים אלף ש"ח בחודש או להרוויח כעצמאי אלפיים ש"ח בחודש? משכורת שכיר של 5000 ש"ח עם כל הזכויות והפרשות המעביד או רווח של 25000 ש"ח כעצמאי שקונה בעצמו קרן פנסיה, ביטוח תאונות אישיות, אובדן עבודה וקרן השתלמות? יוסישיחה 20:46, 22 באוגוסט 2013 (IDT)
מה יותר משתלם? כל מקרה לגופו. ‏Ben-Natan‏ • שיחה 21:33, 22 באוגוסט 2013 (IDT)
אצמצם את השאלה ואענה: עבור מי שמרוויח בערך אותו סכום, הן כעצמאי והן כשכיר ואינו חייב להיות חופשי ממנהלים, נראה שעדיף להיות שכיר. כשכיר יש לו פחות אחריות ופחות סיכונים. עִדּוֹ - שיחה 11:09, 23 באוגוסט 2013 (IDT)

כלל אצבע: כדי להשוות את תנאיך כעצמאי לשכיר, שכרך מעבודה צריך להיות בחמישים אחוז גבוה ממשכורת ברוטו שלך כשכיר. שנילי - שיחה 11:20, 23 באוגוסט 2013 (IDT)

כלל אצבע מעניין. על סמך מה הוא הוסק?. עִדּוֹ - שיחה 11:31, 23 באוגוסט 2013 (IDT)
חישוב מקורב - 5% פנסיה ועוד 2.5% אבדן כושר עבודה, %⅓8 פיצויי פיטורין, 7.5% קרן השתלמות, 8% חופשה שנתית ופער בין דמי בטוח לאומי כעצמאי לשכיר, מביא אותך בקירוב לעלות מעביד של 30% על השכר ברוטו, החישוב ”מלמטה" ולכן עליך להרוויח 150% כדי שיהיה לך 100%. אני מניח שדוד שי ידע לתת את התחשיב במדויק. שנילי - שיחה 11:45, 23 באוגוסט 2013 (IDT)
שנילי צודק בעיקרון שהציג. לנתונים שהביא יש להסיף עוד זכויות שיש לשכיר ואין לעצמאי: דמי מחלה, חגים בתשלום, שי לחג. לזכות של הקביעות, שיש לשכירים רבים, יש גם משקל שניתן להעריכו בכסף. בתשובה זו סטינו מהשאלה המקורית, ועברנו לשאלה (שאולי אליה התכוון השואל): אם מציעים לך עבודה מסוימת כשכיר או כעצמאי, מה צריך להיות התשלום בכל מעמד, כדי שההצעות יהיו שקולות מבחינה כספית? בדרך כלל אדם אינו ניצב בפני שאלה זו, מפני שיש משרות המוצעות רק במעמד שכיר, ואחרות שמוצעות רק במעמד עצמאי. ההסכמה החוזית בין הצדדים אינה מספיקה, מפני שפעמים רבות קבע בית הדין לעבודה שהתקשרות בין הצדדים כעצמאי היא פיקציה שאינה משקפת את טיב היחסים ביניהם, ומדובר למעשה בהתקשרות כשכיר (החלטה שמוציאה את המעביד קרח מכאן ומכאן).
כל האמור לעיל עוסק במצב שבו לעצמאי אין שום הוצאות נוספות כתוצאה מהיותו עצמאי. כאשר ההתקשרות כעצמאי אינה פיקציה, סביר שתלווה בהוצאות נוספות. דוגמה: עורך דין פועל כיועץ משפטי של חברה, ומגיע להסכמה לתת לה אותו שירות, אך כעצמאי. זה יחייב אותו לשכור משרד ושירותי משרד, לרכוש בעצמו את הספרות המקצועית והביטוח הנחוצים לו, ולכן עליו להביא בחשבון גם הוצאות אלה כדי לקבוע מה יהיה התעריף שלו כעצמאי לעומת שכרו כשכיר. דוד שי - שיחה 13:35, 23 באוגוסט 2013 (IDT)

± בטווחי ערכים במדעים[עריכת קוד מקור]

כשמדענים אומרים שגודל מסוים הוא , מה זאת אומרת? שהגודל חסום בין x-y ל-x+y? שהוא מתפלג (כנראה נורמלית) עם תוחלת x וסטיית תקן y? למשל, בערך גיל היקום כתוב "ההערכות האחרונות קובעות שגיל היקום הוא מיליארד שנים". תודה, 21:53, 22 באוגוסט 2013 (IDT) -- הודעה זו הושארה על ידי אנונימי/ת

האפשרות הראשונה שאתה מציין. בנצי - שיחה 00:08, 23 באוגוסט 2013 (IDT)
התשובה דומה יותר לאפשרות השנייה אבל לא זהה לה. התשובה היא, שהגודל מתפלג נורמלית עם עם תוחלת X וסטיית תקן של חצי Y. דהיינו, מעבר למרחק של Y מהתוחלת, אנו מצויים באסימפטוטות של ההתפלגות. עִדּוֹ - שיחה 11:04, 23 באוגוסט 2013 (IDT)
אני לא בטוח שיש בזה כלל אחד. ברוב המוחלט של המקרים זו לא האפשרות הראשונה, וזה קשור לשניה. זה יכול להיות סטיית תקן מלאה, או מחצית רוחב ההתפלגות במחצית הגובה (שזה דומה), או כל רוחב ההתפלגות בחצי הגובה. כניסיונאי, בדרך כלל אני לא מאמין שלמפרסם עצמו יש יכולת להגיד מה מהאפשרויות יותר נכון. בדרך כלל זה גם נגזר מהסתמכות על סדרה של מדידות שכל אחת יכולה להגדיר את השיגאה אחרת, ולא נהוג לדווח על כך. לעידו, אני מניח שאנחנו מתכוונים לאותו הדבר, רק שאתה מגדיר סטיית תקן כ 2 סיגמה ואני כ 1 סיגמה. משה פרידמן - שיחה 14:17, 23 באוגוסט 2013 (IDT)

קמח תירס כחומר הדברה טבעי נגד נמלים[עריכת קוד מקור]

אמת או מיתוס? אם נכון הדבר, אז מהו המנגנון מאחורי זה, והאם עמילן תירס או מוצרים אפויים מקמח תירס גם יפעלו באותו האופן? -- הודעה זו הושארה על ידי אנונימי/ת

נראה שכן. ראה כאן. המנגנון מאחורי זה הוא שהנמלים מתייחסות לקמח התירס כאוכל, אבל אינן מסוגלות לעכל אותו, ולכן בסופו של דבר הן מתות. בלנק - שיחה 02:07, 23 באוגוסט 2013 (IDT)
שאלות על הנושא:

1. מה התהליך הביולוגי שמתרחש? האם הנמלים מתות מחסרים במרכיבי מזון או שמא קמח התירס ״סותם״ את מערכת העיכול שלהן? 2. האם קמח תירס מסוכן גם לחיות אחרות, ספציפית: תיקנים, עכברים, צאן, בקר, דגים, ציפורים כלבים וחתולים?

This works because ants are attracted to corn meal and treat it as food, but they can't actually --digest-- it, causing them to slowly starve. הן מתות מרעב. Nachum - שיחה 11:37, 24 באוגוסט 2013 (IDT)

משאבה לא בהכרח שואבת רק נוזלים או גז[עריכת קוד מקור]

הערך משאבה פותח בפיסקה הבאה:

משאבה היא מכונה, המשמשת להעברת נוזל או גז ובאופן עקיף להגברת לחצו או מהירותו.

הרי כל ילד מכיר ויודע מהו "שואב אבק" או מכונה לטאטוא רחובות. משאבות אלה בדרך כלל לא עשויות לשאוב נוזלים אלא דווקא מוצקים. 46.210.149.99 00:29, 23 באוגוסט 2013 (IDT)
וקיימות גם כמובן משאבות בטון. Mr.Shoval - שיחה 00:33, 23 באוגוסט 2013 (IDT)
לגבי הבטון אני לא יודע, אבל שואב האבק שואב בעיקר אוויר שהוא גז. האבק נשאב רק כתוצר לוואי של שאיבת האוויר. (למרות שזאת כמובן מטרת השאיבה) בלנק - שיחה 02:03, 23 באוגוסט 2013 (IDT)
בלנק צודק, מה גם ש'משאבות בטון' שואבות בטון כשהוא עוד נוזלי ואוי ואבוי אם ינסו לשאוב איתן בטון קשיח, זה פשוט לא יעבוד, בברכה, Nurick - שיחה 03:59, 23 באוגוסט 2013 (IDT)

אפשר בהחלט לשאוב גם אבקות. ולגבי הבטון, בטון הוא עיסה, כמו בצק. הוא לעולם לא ממש נוזל. אז, אפשר גם לשאוב עיסות. השאלה היא אם אנחנו רוצים לכתוב משהו כל כך קטנוני בערך - להבדיל בין תמיסות לבין עיסות בערך על משאבות. עִדּוֹ - שיחה 11:01, 23 באוגוסט 2013 (IDT)

אין כאן עניין של התקטנות. כתוב שם שהוא שואב "נוזל או גז" בעוד שהוא שואב מוצקים כמו עלים, חול, שאריות פלסטיק, שאריות עץ וקרטון, שקיות ועוד. מי שיקרא את הערך ולא ישים לב יחשוב שמשאבה עשויה לשאוב נוזלים או גז וישכח את העובדות הבסיסיות הנ"ל ושמשאבה כוללת גם שואב אבק, זה הכל. לדעתי חשוב מאוד לדייק בעובדות כשכותבים בויקיפדיה. לא מעט פעמים מצטטים ממנה בשיעורי בית או מעיינים בה לצורך הלימודים, וכדאי בהחלט שהדברים בה יהיו מדויקים עד כמה שניתן. 95.35.80.206 12:27, 23 באוגוסט 2013 (IDT)

מה המכנים המשותפים לכל המשאבות?[עריכת קוד מקור]

קראתי בערך משאבות שיש משאבות מסוגים שונים, האם ניתן להצביע על כמה נקודות ולומר שהם המכנה המשותף לכל סוגי המשאבות? דבר שני, שלא שמתי לב שיש אליו התייחסות בערך, זה הנושא של משאבה אקטיבית או פסיבית. יש משאבה שהתפקיד שלה לדחוף (מפוח עלים למשל) ויש משאבה שהתפקיד שלה לשאוב, אולי למשאבה שדוחפת קוראים מדחף?! אני מאוד מבולבל בנושא של הבנת המשאבות ואשמח להסבר. 46.210.149.99 01:07, 23 באוגוסט 2013 (IDT)

Als Pumpen werden ausschließlich Geräte zum Transport inkompressibler Fluide bezeichnet. בוויקי הגרמנית טוענים שמשאבה היא רק לגבי להעברה של נוזל לא דחיס. באנגלית ההגדרה הרבה יותר רחבה. Nachum - שיחה 10:54, 23 באוגוסט 2013 (IDT)

המונח הגיאומטרי העברי ל-Surface of revolution[עריכת קוד מקור]

בגיאומטריה יש צורה שנקראת באנגלית Surface of revolution לצורה זו יש ערך בויקיפדיה האנגלית שמראה את הנוסחאות שלה. בכל אופן, איך צורה זו נקראת בעברית? 95.35.80.206 14:21, 23 באוגוסט 2013 (IDT)

משטח סיבוב. עוזי ו. - שיחה 15:55, 23 באוגוסט 2013 (IDT)

"ככל שמספר הפעימות גדול יותר - כך תוחלת החיים קצרה יותר"[עריכת קוד מקור]

בסוף הערך לב כתובים הדברים הבאים:

באופן כללי, ככל שבעל החיים קטן יותר כך ליבו פועם בתדירות רבה יותר (גם בין צאצא ובוגר מאותו המין). ליבו של לווייתן (היונק הגדול ביותר) פועם 9 פעמים בדקה, של פיל 25 פעמים בדקה, של אדם כ-70 פעמים בדקה, אצל עכבר כ-500 פעמים בדקה וכדומה. קיים יחס הפוך בין קצב פעימות הלב לבין תוחלת החיים הכללית של בעל החיים. ככל שמספר הפעימות גדול יותר, כך תוחלת החיים קצרה יותר.

מישהו יודע מאיפה הכלל המופרך הזה? (אני חושב שעל הכותב היה לציין את המקור (המוטעה) לכך - אם קיים דבר כזה) כיון שפיל חי פחות מאדם ועם זאת קצב פעימות הלב שלו קטן יותר. ראו מה שכתוב בויקיפדיה עצמה בערך פיל:

תוחלת החיים של הפיל ארוכה ביותר, ומתקרבת לזו של האדם. הפיל בטבע חי במשך 70 שנה בממוצע, ורק זוחלים דוגמת צבים ותנינים, ועופות כמו תוכים ונשרים מאריכים ימים יותר ממנו. לעומת זאת, אחת הפילות הזקנות ביותר בעולם בתנאי שביה, נולדה בשנת 1951 וחיה בגן החיות בבזל שבשווייץ עד למותה בשנת 2010 בגיל 59.

האם אתם מכירים עוד דוגמאות (מיצורים אחרים) שסותרות את הכלל הזה?95.35.239.134 19:06, 23 באוגוסט 2013 (IDT)
נראה שגם לגבי לווייתנים המצב לא פשוט: ״תוחלת חייהם של חלק ממיני הלווייתנאים גבוהה ביחס לרוב מיני היונקים ולחלק ממיני הזוחלים. קיימים הבדלים בולטים בין תוחלת החיים של המינים השונים: המינים הקטנים הם בעלי תוחלת חיים של 12-50 שנים, בעוד שתוחלת חייהם של המינים הגדולים נעה בין 50 ל-100 שנים ואף יותר מכך״.
ומתוך הערך על צבים: ״למרות הסכנות והטורפים, הצבים ידועים בתוחלת חייהם הארוכה. כמה מן המינים מאריכי חיים יותר מכל יצור אחר כמעט בממלכת בעלי החיים, לעתים אף עד מאות שנים. ומעניין עוד יותר, על פי מדור המדע של הניו יורק טיימס, איברי גופם אינם מזדקנים, בניגוד למרבית אם לא כל בעלי החיים האחרים. במרץ 2006 למשל, מת בגן החיות של קולקטה, הודו, צב ענק בן 250 שנה. מדענים טוענים, שישנם צבים, אשר בהיעדר מחלה או פציעה יכולים לחיות לנצח‏. רק הלובסטרים ו"המדוזה בת האלמוות" Turritopsis nutricula, ואולי עוד סוג אחד או שניים של בעלי חיים נדירים מתחרים בצבים באורך חייהם הפוטנציאלי״, לא נראה לי סביר שלשלושת הדוגמאות הנל קצב לב איטי משל לוויתן. Uziel302 - שיחה 05:46, 24 באוגוסט 2013 (IDT)
זה כלל אצבע, לא חוק טבע, אבל היחס ההפוך בין קצב פעימות לב (או, בצורה כללית יותר, קצב מטבוליזם) לתוחלת החיים אכן קיים במגוון רחב של מינים. ראה בוויקיפדיה האנגלית en:Heartbeat hypothesis, en:Basal metabolic rate#Longevity וכן המאמר Body size, energy metabolism and lifespan ועוד תוצאות רבות שאפשר למצוא בגוגל כשמחפשים את המילים "rate of metabolism and life expectancy". 94.159.211.187 00:05, 25 באוגוסט 2013 (IDT)
ראה את הערך קצב לב ותוחלת חיים. עמירם פאל - שיחה 09:50, 25 באוגוסט 2013 (IDT)
בספר Physical Activity and Cardiovascular Disease Prevention כרך 2 עמוד 164 מביא את התיאוריה הזאת ואומר שהיא לא מוכחת לגבי בני אדם. 46.210.84.116 20:49, 26 באוגוסט 2013 (IDT)

מה החוק אומר לגבי ריחות (לדוגמא ריח של "על האש")[עריכת קוד מקור]

שלום, אני יודע שיש שעות שאסור לעשות רעש. מה לגבי ריח? אם השכנים שלי עושים "על האש" והריח מגיע עד הסלון שלי, האם יש משהו (מבחינה חוקית) שאני יכול לעשות? תודה ושבת שלום בלי ריחות מסריחים :). אנונימי. -- הודעה זו הושארה על ידי אנונימי/ת

סעיף 3 של החוק למניעת מפגעים, התשכ"א – 1961 קובע כי לא יגרום אדם לריח חזק או בלתי סביר, מכל מקור שהוא אם הוא מפריע או עשוי להפריע, לאדם המצוי בקרבת מקום או לעוברים ושבים.

עיין בקישור: [5]. Uziel302 - שיחה 06:16, 24 באוגוסט 2013 (IDT)

מהירות חוקית בדרך מהירה[עריכת קוד מקור]

בדצמבר 2012 דווח בהרחבה על כך ששר התחבורה אישר העלאת מהירות הנסיעה בכביש 6 ל-120 קמ"ש, אך מקביל דובר שזה מחייב שינוי חקיקה של תקנות התעבורה. האם שונתה החקיקה או שהנושא ירד מסדר היום? כביש 6 הינו "דרך מהירה", ולפי תקנה 54 (א) (1) לתקנות התעבורה המהירות המרבית המותרת בה היא 110 קמ"ש. חזרתישיחה 10:34, 24 באוגוסט 2013 (IDT)

לפי אתר כביש 6 המהירות המותרת היא עדיין 110 קמ"ש NiD123 - שיחה 10:46, 24 באוגוסט 2013 (IDT)

היסטוריון רומאי בשם פרונטו[עריכת קוד מקור]

מישהו מכיר היסטוריון רומאי בשם פרונטו?

(מוזכר כאן - http://numis.co.il/barcocva.pdf)

לא, והוא גם לא מופיע כאן. בלנק - שיחה 02:24, 25 באוגוסט 2013 (IDT)
גם לי זו נראית טעות. לא שמעתי על עדות מקבילה לזו של קסיוס דיו. ‏DGtal‏ 09:38, 25 באוגוסט 2013 (IDT)

מה נסגר עם הערכים הביולוגיים/רפואיים בויקיפדיה?[עריכת קוד מקור]

בערך שנקרא קצב לב ותוחלת חיים (צריך כזה ערך בויקיפדיה?! למה לא פשוט לסנף אותו לערך ראשי) כתוב כך:

קצב לב ותוחלת חיים - מחקרים עדכניים מצביעים על קשר ויחס הפוך, בין קצב פעימות הלב לבין תוחלת החיים. קצב פעימות לב אנושי אופטימלי נקבע כיום (2013) על 50 פעימות בדקה בזמן מנוחה. ככל שהקצב במנוחה עולה, כן צפוי אותו אדם לחיים קצרים יותר ולהיפך‏[1]‏[2]. התופעה היא אוניברסלית, לא רק באדם, אלא בכל עולם החי. ככל שיש לבעל החיים קצב פעימות לב גבוה יותר, תוחלת חייו קצרה יותר‏[3].

האם מי שכתב את זה מודע לכך שהקצב 'האופטימלי' הזה, הוא בעצם מחייב פינוי דחוף לבית החולים?! קצב של 50 בדקה זה בעיה קרדיאלית שנקראת ברדיקרדיה, הלזה יקרא 'קצב אופטימלי'?! הקצב האופטימלי הידוע לכל אנשי הרפואה הוא קצב של 60 בדקה. 95.35.88.167 00:27, 25 באוגוסט 2013 (IDT)

הנתון אומנם נשמע תמוהה אבל- ידוע שלספורטאים ואנשים העוסקים בפעילות גופנית יהיה קצב לב איטי מהממוצע. (אם לאדם הנראה בריא יש דופק נמוך, מקובל לשאול אותו האם הוא עוסק בפעילות גופנית באופן קבוע) גם ידוע שלאלה יש הכי פחות סיכוי לחלות במחלות לב. לכן לא נשמע בלתי אפשרי שזהו אכן הקצב האופטימלי, וצריך לבדוק את זה לפני שמשנים. ככה או ככה, גם אצל עצלנים קצב לב של 50 אינו מחייב פינוי דחוף לבית חולים (אף שזה מתחת לטווח התקין). בלנק - שיחה 02:21, 25 באוגוסט 2013 (IDT)
המידע המובא בערך מדוייק ונכון. הוספתי לטובת האנונימי עוד מקור גם בעברית, בנוסף ל"ניו יורק טיימס" ול - "Heart", המובאים במשפט הבא שם, שבאנגלית. אתלטים בעלי כושר גופני גבוה מגיעים אפילו לכ-40 פעימות בדקה. עמירם פאל - שיחה 08:58, 25 באוגוסט 2013 (IDT)
הערך הנ"ל רחוק מלהיות מדויק. לספורטאים (מקצועיים שעוסקים בזה מהבוקר ועד הערב, לא חובבנים) אכן יש דופק נמוך, אך לא נמוך במיוחד בשעת מנוחה. ובכל מקרה, אי אפשר להשליך מהם על כולם ולומר שהקצב האופטימלי הוא 50 גם ללא ספורטאים, זה בהחלט מחייב פינוי לבית החולים לטיפול. כל רופא משפחה נורמלי שולח לבית החולים על קצב כזה, אין בזה שום ספק. ב'מקורות' הנ"ל (לפי מה שקראתי) לא מופיע דבר וחצי דבר על 'הקצב האופטימלי' של 50. המקור שם הוא אחיזת עיניים, ולכן הייתי שם שם תבנית של דרוש מקור - אבל מקור מדעי אמין שמתייחס לזה ישירות.176.13.1.78 13:09, 25 באוגוסט 2013 (IDT)
מציע לך, 176.13.1.78, לציין זאת בדף השיחה של הערך. 84.110.120.127 14:12, 26 באוגוסט 2013 (IDT)

האם קיימים נוגדנים גם לחיידקים או רק לווירוסים?[עריכת קוד מקור]

ראיתי בדיקה שנקראת Ab Brucella לפי מיטב ידיעתי זה חידק. אז בעצם בודקים אם הגוף פיתח נוגדנים לחידק? 176.13.1.78 01:55, 25 באוגוסט 2013 (IDT)

כפי שניתן לבדוק בערך נוגדן, יש נוגדנים גם לחיידקים, וגם לדברים נוספים מלבד וירוסים. Brucella הוא אכן חיידק, אבל את משמעות הבדיקה אני לא יודע. בלנק - שיחה 02:46, 25 באוגוסט 2013 (IDT)
הערך נוגדן מקשר לערך פתוגניות, ושם מוזכרים דברים אחרים חוץ מוירוסים. --‏Manedwolf‏ • שיחה 15:06, 25 באוגוסט 2013 (IDT)
יתרה מזו, הגוף מייצר נוגדנים כנגד כל דבר שהוא לא מזהה לעצמי. אחד הדרכים הנפוצות לעבודה בביולוגיה על נוגדנים, היא להזריק תאים מיצור אחד למשנהו, כדי שהשני ייצור נוגדנים כנגד החלבונים של הראשון. זהו גם אחד המורכבויות בהשתלה, כאשר הגוף המקבל מזהה את השתל כמשהו לא עצמי ומייצר כנגדו נוגדנים.